BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000627-TA|BGIBMGA000627-PA|IPR000449|Ubiquitin- associated/Translation elongation factor EF1B, N-terminal, IPR000608|Ubiquitin-conjugating enzyme, E2, IPR009060|UBA-like (199 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 6.7 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 23.0 bits (47), Expect = 1.7 Identities = 15/53 (28%), Positives = 21/53 (39%) Query: 94 DILKDQWAAALTLRTVLLSLQALLSAGEPNDPQDAVVAKQFRENPRLFTMTAR 146 D++KD + L+ L+ LLS G D K + L T T R Sbjct: 80 DVIKDNYRKVTDLKKRFPKLKVLLSVGGNADVSGQDEEKNIKYRNLLETTTRR 132 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.0 bits (42), Expect = 6.7 Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 94 DILKDQWAAALTLRTVLLSLQALLSAGEPND 124 DI++ + + L+ V L+ L+S GE D Sbjct: 229 DIIQGGYISVTGLKRVNPKLKVLISVGEGRD 259 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.135 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,975 Number of Sequences: 317 Number of extensions: 1864 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 199 length of database: 114,650 effective HSP length: 54 effective length of query: 145 effective length of database: 97,532 effective search space: 14142140 effective search space used: 14142140 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -