BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000624-TA|BGIBMGA000624-PA|IPR001452|Src homology-3, IPR003599|Immunoglobulin subtype, IPR003598|Immunoglobulin subtype 2, IPR003961|Fibronectin, type III, IPR003962|Fibronectin, type III subdomain, IPR007110|Immunoglobulin-like, IPR013098|Immunoglobulin I-set, IPR008957|Fibronectin, type III-like fold (2130 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_06_0311 + 33054022-33054118,33056109-33056353,33057058-330573... 36 0.27 11_04_0045 + 12731603-12732487,12732572-12732647,12744290-12745371 33 1.9 09_06_0311 + 22218219-22218421,22219157-22219422,22219881-222200... 33 2.5 11_01_0236 + 1811822-1812971,1814930-1814979,1815676-1816116,181... 33 3.3 09_02_0251 - 6282420-6282526,6282642-6283104,6283223-6283289,628... 32 4.4 06_03_0477 - 21250811-21250981,21251261-21251374,21251447-212516... 32 4.4 05_03_0470 + 14448243-14448482,14448568-14449181,14449508-144501... 32 4.4 06_02_0194 + 12885340-12885708,12886098-12886367,12886476-128865... 32 5.8 04_03_0166 + 12175952-12176045,12176080-12176762 32 5.8 04_04_0076 + 22558105-22558261,22558356-22558405,22559837-225600... 31 7.7 04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902,420... 31 7.7 02_04_0612 + 24370446-24373044,24373135-24373541 31 7.7 02_02_0556 - 11444512-11445577,11445730-11446007 31 7.7 >03_06_0311 + 33054022-33054118,33056109-33056353,33057058-33057398, 33057488-33057538,33057623-33057695,33058229-33058333, 33060124-33060206,33061209-33061249,33061659-33063120, 33063368-33064847,33064958-33065122,33065232-33065424, 33065502-33065613,33065702-33065849,33065951-33066148, 33066234-33066512,33066612-33066773,33066872-33067090, 33067481-33067612 Length = 1861 Score = 36.3 bits (80), Expect = 0.27 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 9/80 (11%) Query: 174 PQNIIEEAKSEPKLIEESEQPIAKTSEIDNEVPEKINVPDDKETSQTPTSFNKRSKLTPI 233 P + EE ++EPK I++ ++ DN+ E++NV D+K T P++ +++S Sbjct: 994 PGDTKEEDQNEPKEIDDDQE-----ENEDNDAEEEVNVQDEKATRTPPSTRSRKSSAD-- 1046 Query: 234 KIERKEMEVSTPQHAETVDG 253 RKE++ +TV G Sbjct: 1047 --TRKEIKWEGQTAGKTVSG 1064 >11_04_0045 + 12731603-12732487,12732572-12732647,12744290-12745371 Length = 680 Score = 33.5 bits (73), Expect = 1.9 Identities = 28/74 (37%), Positives = 38/74 (51%), Gaps = 11/74 (14%) Query: 148 LERVTLEKSDLFDSQEDESKPDVSQPPQNIIEEAKSEPKLIEESEQPIAKTSEIDNEVPE 207 L+R+ LE + F Q DE +P+ S IEE P IE +P S ID +VPE Sbjct: 470 LDRI-LENTS-FMMQSDEPQPEASVSK---IEE----PLTIEPLSKPSTSASSIDEKVPE 520 Query: 208 KINVPDDKETSQTP 221 ++ P + E QTP Sbjct: 521 QL--PVENEEIQTP 532 >09_06_0311 + 22218219-22218421,22219157-22219422,22219881-22220050, 22220149-22220365,22220798-22221021,22221559-22221738, 22221875-22222013,22222107-22222255,22223394-22223505, 22223998-22224506,22224661-22224784,22224904-22225178, 22225507-22225626,22225707-22225769,22225861-22226052, 22226381-22226440,22226535-22226738,22226926-22227051, 22227093-22227254,22227357-22227476,22227665-22227820, 22227895-22227957,22228041-22228168,22228524-22228920, 22229442-22229544,22229646-22229776,22230096-22230167, 22230472-22230553,22231083-22231190,22231288-22231429, 22231659-22231698,22231746-22231876,22232215-22232301, 22232395-22232605,22232687-22232741,22232836-22232927, 22233011-22233071,22233361-22233719 Length = 2010 Score = 33.1 bits (72), Expect = 2.5 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 10/118 (8%) Query: 1139 WFKDGSEIQFSNHIQLTIDGKKQKLKIYDCDLDDAGEYSCEVGNSKCTAILTVEEPSINF 1198 WF +GS F NH+ GK + CD G S + S IL V +P + Sbjct: 1305 WFSNGSSNAFINHVIGRSAGKTKISVSITCDFLMTGS-SGSIAYSASKTILVVPDPPL-- 1361 Query: 1199 TLRLPEFILVPANTDAYLTVEIPDETLDVTWYKKKSVIEDTEKFTLISDVKKRTLIIR 1256 L LP L P Y T ++ ++D +E T ++L+ ++ K L+++ Sbjct: 1362 ALGLPITWLFP---PFYTTTDLLPRSVD----PDSDDLESTIGYSLLRNIGKSDLVLQ 1412 >11_01_0236 + 1811822-1812971,1814930-1814979,1815676-1816116, 1816199-1816309,1816934-1817074,1817153-1817323, 1817421-1817625,1817714-1817886,1817997-1818079, 1818487-1818626,1818806-1818891,1818957-1819142, 1819172-1819365,1820387-1820736,1821153-1821235 Length = 1187 Score = 32.7 bits (71), Expect = 3.3 Identities = 14/44 (31%), Positives = 27/44 (61%) Query: 335 DVEKTELEQPLFSYEDIVESKKDENEIIQEKQTLEELPKEDVPE 378 D E+ E+E+ YE+I E ++E E+ +++ +EE+ + D E Sbjct: 434 DDEEEEVEEEEIEYEEIEEEIEEEEEVEEDEDVVEEVEEVDEEE 477 >09_02_0251 - 6282420-6282526,6282642-6283104,6283223-6283289, 6283536-6283808,6284096-6284907,6285402-6285479, 6285586-6285636,6285737-6285817,6285903-6285982, 6288481-6288652 Length = 727 Score = 32.3 bits (70), Expect = 4.4 Identities = 20/58 (34%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 349 EDIVESKKDENEIIQEKQTLEELPKEDVPEQYTITPRKSSAQK--IDEIVDEVTIKKR 404 ED ++ +E E +QEK+T EE +D P+Q RKS +K +++++D KK+ Sbjct: 633 EDETITEPNEEEQLQEKETNEEEEIQD-PDQANTKGRKSIRRKRIVEQMIDNNNKKKK 689 >06_03_0477 - 21250811-21250981,21251261-21251374,21251447-21251613, 21252051-21252153,21252315-21252367,21252438-21252570, 21252835-21253183,21253685-21254003,21254519-21254717 Length = 535 Score = 32.3 bits (70), Expect = 4.4 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 5/86 (5%) Query: 1323 VNSKIIKKCKHTKPSIDSKSASLTIKKVENTDAGIYKLRLENNCGH--ADVEMNV-TILD 1379 ++SKI+ +CK T I K A L + +E D + +++E G D E+ I+D Sbjct: 169 LSSKIVNRCKRTLAEIAVK-AVLAVADLERKDVNLDLIKVEGKVGGKLEDTELVYGIIVD 227 Query: 1380 KP-SPPGKPNILEIDSSSINICWDEP 1404 K S P P +E +I C EP Sbjct: 228 KDMSHPQMPKRIEDAKIAILTCPFEP 253 >05_03_0470 + 14448243-14448482,14448568-14449181,14449508-14450135, 14450217-14450827,14450911-14451162,14451243-14451353, 14451441-14451501,14451603-14451695,14451773-14451940 Length = 925 Score = 32.3 bits (70), Expect = 4.4 Identities = 30/103 (29%), Positives = 45/103 (43%), Gaps = 5/103 (4%) Query: 1557 GEVETSCVVGIQQKPVITISNEDIKQKHKVGDEWL-VTAVIEGIPPPEVIWYKNGNKLEN 1615 GE E S V + +P + VGDE ++ + P P K GN E+ Sbjct: 14 GEQELSLAVVVAPEPTVPPKGSS---NCDVGDEDEDYSSPSDPCPSPSPKRRKKGNSEED 70 Query: 1616 DKEYNITTKEKTSVIRIK-ELKRSHSSKYTIEASNTAGTSSVE 1657 DK+Y + +T+ R K + K+ SK +NT GT +E Sbjct: 71 DKDYIPPKEGETAPRRSKRQPKKKVPSKDDDVPANTTGTKKIE 113 >06_02_0194 + 12885340-12885708,12886098-12886367,12886476-12886592, 12888044-12888094,12889599-12889719,12890146-12890311, 12890598-12890691 Length = 395 Score = 31.9 bits (69), Expect = 5.8 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Query: 1615 NDKEYNITTKEKTSVIRIKELKRSHSSKYTIEASNTAGTSSVEVTLKVYDKPSKPE 1670 +D+E +E+ S + I+E++ S YTI + + T + L+V+DK + PE Sbjct: 232 SDEEIRQIIQEEGSFL-IREMQFDPFSYYTIVLQHESSTKVANIALEVFDKNTSPE 286 >04_03_0166 + 12175952-12176045,12176080-12176762 Length = 258 Score = 31.9 bits (69), Expect = 5.8 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 11/85 (12%) Query: 148 LERVTLEKSDLFDSQEDESKPDVSQPPQNIIEEAKSEPKLIEESEQPIAKTSEIDNEVPE 207 L+R+ S + + E++SK VS+ IEE P ++ QP S ID +VPE Sbjct: 181 LDRILENTSFMTQTNENQSKASVSK-----IEE----PLTMKPLAQPSTSASSIDEKVPE 231 Query: 208 KINVPDDKETSQTPTSFNKRSKLTP 232 + +V + E QTP + + +P Sbjct: 232 QPSV--ENEEIQTPDRESSTTHRSP 254 >04_04_0076 + 22558105-22558261,22558356-22558405,22559837-22560044, 22560112-22560237,22560469-22560567,22560729-22561405, 22561483-22561731,22561808-22561936,22562021-22562089, 22562183-22562256,22563086-22563098,22563361-22563468, 22563541-22563651,22563725-22563811,22564043-22564068, 22564840-22564906,22565123-22565212,22565295-22565387, 22565515-22565604,22565699-22565761,22566349-22566447 Length = 894 Score = 31.5 bits (68), Expect = 7.7 Identities = 35/128 (27%), Positives = 56/128 (43%), Gaps = 10/128 (7%) Query: 1621 ITTKEKTSVIRIKELKRSHSSKYTIEASNTAGTSSVEVTLKVYDKPSKPEGPVIMREISR 1680 I KE+ ++ K K ++AS A S + K YD EG I E+S+ Sbjct: 499 IDEKEQLHTCAVEREKNLEEQKLQVQASLAATESQLTEAKKQYD--IMLEGKKI--ELSK 554 Query: 1681 ESVTIEWKPPLDDGGLELT-KYAIEKHEPDNNRWIKVADVDRDVETYCIQKLNEN---CE 1736 + K D E+ KY +EK E N K + +++E C +K++EN E Sbjct: 555 HLKELSLKN--DQAINEIRRKYELEKVEIINIEKEKAEKLIKEMENKCNEKISENRQDSE 612 Query: 1737 YMFRVIAQ 1744 F ++A+ Sbjct: 613 SSFEMVAR 620 >04_01_0312 + 4206400-4206627,4206661-4207269,4207425-4207902, 4208006-4208297,4209278-4209569,4210013-4210465 Length = 783 Score = 31.5 bits (68), Expect = 7.7 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Query: 163 EDESKPDVSQPPQNIIEEAK-SEPKLIEESEQPIAKTSEIDNEVPEKINVPDDKETSQTP 221 E+ S S PQ +K EP +IE +P S ID +VPE+ V + E QTP Sbjct: 194 ENTSFMTQSNEPQPEASVSKIEEPLMIEPLAEPSTSASSIDEKVPEQPTV--ENEEIQTP 251 >02_04_0612 + 24370446-24373044,24373135-24373541 Length = 1001 Score = 31.5 bits (68), Expect = 7.7 Identities = 15/39 (38%), Positives = 24/39 (61%) Query: 208 KINVPDDKETSQTPTSFNKRSKLTPIKIERKEMEVSTPQ 246 +I++ ++ T Q P+SF K SKL+ I +E +E S Q Sbjct: 298 EISMANNYFTGQIPSSFGKLSKLSYISLENNSLEASDGQ 336 >02_02_0556 - 11444512-11445577,11445730-11446007 Length = 447 Score = 31.5 bits (68), Expect = 7.7 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Query: 171 SQPPQNIIEEAK-SEPKLIEESEQPIAKTSEIDNEVPEKINVPDDKETSQTP 221 S PQ +K EP IE +P T ID +VPE+ +V + E QTP Sbjct: 4 SDEPQLEASVSKIEEPSAIESQSEPSTSTDLIDEKVPEQPSV--ENEEIQTP 53 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.312 0.131 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 60,017,831 Number of Sequences: 37544 Number of extensions: 2513548 Number of successful extensions: 4749 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 4738 Number of HSP's gapped (non-prelim): 22 length of query: 2130 length of database: 14,793,348 effective HSP length: 93 effective length of query: 2037 effective length of database: 11,301,756 effective search space: 23021676972 effective search space used: 23021676972 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 68 (31.5 bits)
- SilkBase 1999-2023 -