BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000621-TA|BGIBMGA000621-PA|IPR000886|Endoplasmic reticulum targeting sequence, IPR002654|Glycosyl transferase, family 25 (402 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0724 + 20975942-20976867,20977397-20977476,20977976-209783... 30 3.8 >07_03_0724 + 20975942-20976867,20977397-20977476,20977976-20978370, 20988410-20989444 Length = 811 Score = 29.9 bits (64), Expect = 3.8 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 2/79 (2%) Query: 217 CDEIYMINLERRQERRFLMELSFKELGMSVQHFSAIDGRNLDMNDLREYSITLMPNYE-D 275 CD I +++E ++ R+ M ++G+ Q + N+D ND+ E SI + +Y+ D Sbjct: 666 CD-IVAVDMEGKKWRKIPMPDPDGDIGIIHQTQGRLCAFNVDPNDILELSIWFLEDYDTD 724 Query: 276 PYHKRYIGRKILLDGEEEY 294 + ++ I L G ++Y Sbjct: 725 NWILKHTVSSINLFGRKKY 743 Score = 28.7 bits (61), Expect = 8.7 Identities = 19/78 (24%), Positives = 41/78 (52%), Gaps = 1/78 (1%) Query: 218 DEIYMINLERRQERRFLMELSFKELGMSVQHFSAIDGRNLDMNDLREYSITLMPNYE-DP 276 DEI +++E ++ R+ M ++G+ Q + N+D ND+ + SI + +Y+ D Sbjct: 165 DEIVAVDIEGKKWRKIPMPDPDGDIGIIHQTQGRLCAFNVDPNDIFKLSIWFLQDYDTDN 224 Query: 277 YHKRYIGRKILLDGEEEY 294 + ++ + L G ++Y Sbjct: 225 WILKHTVGSMKLFGGKKY 242 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.137 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,701,550 Number of Sequences: 37544 Number of extensions: 568105 Number of successful extensions: 988 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 987 Number of HSP's gapped (non-prelim): 2 length of query: 402 length of database: 14,793,348 effective HSP length: 84 effective length of query: 318 effective length of database: 11,639,652 effective search space: 3701409336 effective search space used: 3701409336 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -