GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000620-TA|BGIBMGA000620-PA|IPR005199|Glycoside hydrolase
family 79, N-terminal
         (514 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13 pro...    23   3.8  

>DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13
           protein.
          Length = 377

 Score = 23.4 bits (48), Expect = 3.8
 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 4/57 (7%)

Query: 450 HEYIISAPSNNRKSKTILLNGWPLYYESNLHNLRPN----IHRYGRYVSLPPYSIGF 502
           H +I+S PS +  +      G P  Y  NL +L  N     HR G  V L    + +
Sbjct: 260 HHFILSDPSKHGLNDATAAPGEPGPYTVNLGSLGYNEICEFHRNGTVVFLDDMKVPY 316


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.321    0.137    0.431 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,421
Number of Sequences: 317
Number of extensions: 6178
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 514
length of database: 114,650
effective HSP length: 60
effective length of query: 454
effective length of database: 95,630
effective search space: 43416020
effective search space used: 43416020
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)