BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000620-TA|BGIBMGA000620-PA|IPR005199|Glycoside hydrolase
family 79, N-terminal
(514 letters)
Database: tribolium
317 sequences; 114,650 total letters
Searching....................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13 pro... 23 3.8
>DQ659252-1|ABG47450.1| 377|Tribolium castaneum chitinase 13
protein.
Length = 377
Score = 23.4 bits (48), Expect = 3.8
Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 4/57 (7%)
Query: 450 HEYIISAPSNNRKSKTILLNGWPLYYESNLHNLRPN----IHRYGRYVSLPPYSIGF 502
H +I+S PS + + G P Y NL +L N HR G V L + +
Sbjct: 260 HHFILSDPSKHGLNDATAAPGEPGPYTVNLGSLGYNEICEFHRNGTVVFLDDMKVPY 316
Database: tribolium
Posted date: Oct 5, 2007 11:13 AM
Number of letters in database: 114,650
Number of sequences in database: 317
Lambda K H
0.321 0.137 0.431
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,421
Number of Sequences: 317
Number of extensions: 6178
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 5
Number of HSP's gapped (non-prelim): 1
length of query: 514
length of database: 114,650
effective HSP length: 60
effective length of query: 454
effective length of database: 95,630
effective search space: 43416020
effective search space used: 43416020
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 45 (22.2 bits)
- SilkBase 1999-2023 -