BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000618-TA|BGIBMGA000618-PA|IPR001179|Peptidylprolyl isomerase, FKBP-type (62 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 0.72 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 0.72 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 0.72 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 0.72 DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory pro... 21 1.3 AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 ... 18 8.9 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 0.72 Identities = 10/37 (27%), Positives = 18/37 (48%) Query: 18 PEVTELKTEVVSVPEGCTTKSKHGDMLTMHYTGTLDD 54 P+ E+K E+ P+ K+ T +Y ++DD Sbjct: 212 PKKKEVKEEIEDEPDHKWKKNDSSKKKTRYYYRSVDD 248 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 0.72 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 17 GPEVTELKTEVVSVPEGCT 35 GP++TEL+ E + + T Sbjct: 282 GPQITELEPETIESQDAIT 300 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 0.72 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 17 GPEVTELKTEVVSVPEGCT 35 GP++TEL+ E + + T Sbjct: 515 GPQITELEPETIESQDAIT 533 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 0.72 Identities = 7/19 (36%), Positives = 12/19 (63%) Query: 17 GPEVTELKTEVVSVPEGCT 35 GP++TEL+ E + + T Sbjct: 515 GPQITELEPETIESQDAIT 533 >DQ855496-1|ABH88183.1| 129|Tribolium castaneum chemosensory protein 10 protein. Length = 129 Score = 20.6 bits (41), Expect = 1.3 Identities = 7/15 (46%), Positives = 8/15 (53%) Query: 34 CTTKSKHGDMLTMHY 48 CT K K G +HY Sbjct: 78 CTEKQKEGSRKIIHY 92 >AF263514-1|AAF74206.1| 127|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 127 Score = 17.8 bits (34), Expect = 8.9 Identities = 11/35 (31%), Positives = 17/35 (48%) Query: 1 MTTLRCVLMLVALAGAGPEVTELKTEVVSVPEGCT 35 M TLR + +A + +L + +VP GCT Sbjct: 53 METLRMFPPVPIIARQLNQDLKLASGDYTVPAGCT 87 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.318 0.133 0.392 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,068 Number of Sequences: 317 Number of extensions: 346 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 62 length of database: 114,650 effective HSP length: 42 effective length of query: 20 effective length of database: 101,336 effective search space: 2026720 effective search space used: 2026720 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.5 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -