BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000617-TA|BGIBMGA000617-PA|IPR000727|Target SNARE coiled-coil region, IPR010989|t-snare, IPR006012|Syntaxin/epimorphin family (221 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 2.3 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 21 6.9 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/45 (24%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Query: 2 VNQLQTPQDSQELRAQLRQIQNYTQKLAKDTSSLLMELMRMPKDN 46 +N+ + ++++L + NY K KD + +E+ PK N Sbjct: 438 INEEKRTIENEQLNRMYKSYPNYIDKETKDMN---LEISTRPKSN 479 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/27 (29%), Positives = 16/27 (59%) Query: 2 VNQLQTPQDSQELRAQLRQIQNYTQKL 28 +N L P D+QE + Q+ + + T ++ Sbjct: 165 MNFLIYPHDTQECKLQMESLSHTTDEM 191 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.310 0.123 0.315 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,993 Number of Sequences: 429 Number of extensions: 1304 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 221 length of database: 140,377 effective HSP length: 55 effective length of query: 166 effective length of database: 116,782 effective search space: 19385812 effective search space used: 19385812 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -