BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000615-TA|BGIBMGA000615-PA|IPR003104|Actin-binding FH2 (1199 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 27 0.77 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 27 0.77 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 27 1.0 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.77 Identities = 16/59 (27%), Positives = 29/59 (49%) Query: 955 LLYHICEMIIEKFPDSTDFFSEVGPVIRASKVDFDILSVNLQKLESDCKASWDHMKRVA 1013 L++ M+I+ F F +I +++DFD+ S + ++ D S D +K VA Sbjct: 1288 LIFFALLMVIQFFAMMIHRFGTFSQIITKTQLDFDLCSKPIDEMTVDELRSRDPIKIVA 1346 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 27.1 bits (57), Expect = 0.77 Identities = 16/59 (27%), Positives = 29/59 (49%) Query: 955 LLYHICEMIIEKFPDSTDFFSEVGPVIRASKVDFDILSVNLQKLESDCKASWDHMKRVA 1013 L++ M+I+ F F +I +++DFD+ S + ++ D S D +K VA Sbjct: 1288 LIFFALLMVIQFFAMMIHRFGTFSQIITKTQLDFDLCSKPIDEMTVDELRSRDPIKIVA 1346 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 26.6 bits (56), Expect = 1.0 Identities = 15/35 (42%), Positives = 19/35 (54%) Query: 1142 SLTEGRRKSQASTNRMLVNGDLSADDEIIESLVRS 1176 SLTEG+R ++ NGD S D+ ESL S Sbjct: 70 SLTEGKRSKRSKRPNGDTNGDTSQVDDQNESLEAS 104 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.317 0.133 0.377 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 239,743 Number of Sequences: 317 Number of extensions: 9798 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 4 length of query: 1199 length of database: 114,650 effective HSP length: 65 effective length of query: 1134 effective length of database: 94,045 effective search space: 106647030 effective search space used: 106647030 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 48 (23.4 bits)
- SilkBase 1999-2023 -