BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000614-TA|BGIBMGA000614-PA|undefined (511 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 31 0.023 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 24 3.4 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 31.1 bits (67), Expect = 0.023 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Query: 451 DIDDILGTSGQIYSPFMDSIL-ARRTGQTLLDEDVCEEIDPTQVRIHDSTA 500 DIDD +G + F+D ++ A + G L D++V E++D HD+TA Sbjct: 306 DIDDDVGEKKR--QAFLDLLIEAGQNGVLLTDKEVKEQVDTIMFEGHDTTA 354 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.8 bits (49), Expect = 3.4 Identities = 8/19 (42%), Positives = 15/19 (78%) Query: 341 GERPWWLSSDKNIPEGIDK 359 GERP+W S++++ + I+K Sbjct: 835 GERPYWNWSNQDVIKSIEK 853 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.309 0.127 0.372 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,773 Number of Sequences: 429 Number of extensions: 6277 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 3 length of query: 511 length of database: 140,377 effective HSP length: 61 effective length of query: 450 effective length of database: 114,208 effective search space: 51393600 effective search space used: 51393600 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -