BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000611-TA|BGIBMGA000611-PA|undefined (62 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC036659-1|AAH36659.1| 1170|Homo sapiens WD repeat domain 35 pro... 28 5.3 AC079145-3|AAX88936.1| 1170|Homo sapiens unknown protein. 28 5.3 AB037757-1|BAA92574.2| 1219|Homo sapiens KIAA1336 protein protein. 28 5.3 >BC036659-1|AAH36659.1| 1170|Homo sapiens WD repeat domain 35 protein. Length = 1170 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 11 ADTSRHVRLALQRSLYDWQMAMTIPLSAVASLRVACAQPRRCAKIIHIDVPP 62 A T HV A + + Y WQ + L+A+ ++ ++ +I H+D P Sbjct: 424 AMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDTP 475 >AC079145-3|AAX88936.1| 1170|Homo sapiens unknown protein. Length = 1170 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 11 ADTSRHVRLALQRSLYDWQMAMTIPLSAVASLRVACAQPRRCAKIIHIDVPP 62 A T HV A + + Y WQ + L+A+ ++ ++ +I H+D P Sbjct: 424 AMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDTP 475 >AB037757-1|BAA92574.2| 1219|Homo sapiens KIAA1336 protein protein. Length = 1219 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/52 (26%), Positives = 25/52 (48%) Query: 11 ADTSRHVRLALQRSLYDWQMAMTIPLSAVASLRVACAQPRRCAKIIHIDVPP 62 A T HV A + + Y WQ + L+A+ ++ ++ +I H+D P Sbjct: 473 AMTKTHVIAASKEAFYTWQYRVAKKLTALEINQITRSRKEGRERIYHVDDTP 524 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.327 0.133 0.418 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,731,790 Number of Sequences: 224733 Number of extensions: 265943 Number of successful extensions: 417 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 414 Number of HSP's gapped (non-prelim): 3 length of query: 62 length of database: 73,234,838 effective HSP length: 42 effective length of query: 20 effective length of database: 63,796,052 effective search space: 1275921040 effective search space used: 1275921040 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.8 bits) S2: 57 (27.1 bits)
- SilkBase 1999-2023 -