BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000608-TA|BGIBMGA000608-PA|IPR001623|Heat shock protein DnaJ, N-terminal (358 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0650 + 10174905-10175000,10175321-10175376,10175467-101755... 52 9e-07 03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757,639... 50 2e-06 02_05_0699 + 31013176-31013345,31013749-31013872,31013950-310140... 50 3e-06 05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390,149... 50 4e-06 06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524,717... 49 5e-06 01_01_0013 + 81507-81932,82718-82864 48 9e-06 05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 48 1e-05 06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425,604... 48 2e-05 05_03_0564 - 15502458-15503303,15503394-15503474,15503572-155036... 48 2e-05 05_03_0563 - 15493570-15494415,15494506-15494586,15494684-154947... 48 2e-05 05_03_0562 - 15484733-15485578,15485669-15485749,15485847-154858... 48 2e-05 11_01_0725 - 5987706-5988126,5988610-5988902 47 3e-05 02_05_0821 - 32019775-32019882,32020296-32020352,32020614-320206... 47 3e-05 02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559,533... 46 6e-05 03_06_0049 + 31282563-31282841,31283052-31283903,31284109-312841... 45 8e-05 02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 45 8e-05 01_05_0646 + 23907837-23907956,23908077-23908164,23908282-239083... 45 8e-05 01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 44 1e-04 08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 44 2e-04 01_07_0380 + 43181564-43181639,43182053-43182218,43182494-431826... 44 2e-04 02_05_0183 + 26537676-26537752,26538481-26538649,26538736-265389... 44 2e-04 01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 44 2e-04 08_02_1300 + 25972496-25972582,25972664-25972723,25973786-259738... 43 3e-04 06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-92... 43 3e-04 03_02_0704 - 10542187-10542339,10542466-10542522,10542667-105427... 43 3e-04 04_03_0283 + 13887388-13887573,13887711-13887806,13888517-138886... 43 4e-04 12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505,345... 42 6e-04 08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 42 8e-04 06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341,487... 42 8e-04 02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658,147... 42 0.001 03_06_0226 + 32495088-32495237,32496189-32496351,32496438-324965... 41 0.001 02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675,535... 41 0.001 05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872,324... 41 0.002 02_05_0381 - 28483425-28483458,28483588-28483658,28483746-284838... 41 0.002 09_03_0078 + 12137124-12137672 40 0.002 05_04_0387 - 20834510-20834978,20836866-20837329,20837458-20837634 40 0.002 04_04_0712 + 27476319-27476569,27477150-27477402,27477535-274779... 40 0.003 08_02_0878 + 22152437-22152532,22152619-22152718,22152907-221529... 40 0.004 03_05_0497 + 24932336-24932485,24934037-24934199,24934306-249344... 40 0.004 08_02_1491 + 27500532-27500972 39 0.005 04_03_0735 + 19141038-19143227 39 0.005 02_04_0220 - 21014225-21014386,21014492-21014572,21014739-210149... 39 0.005 12_02_0454 + 19199063-19200757,19202201-19202287 39 0.007 10_08_0580 - 18912364-18912420,18912524-18912631,18912973-189132... 38 0.009 06_03_1400 + 29901835-29902136,29902913-29902934 38 0.012 02_03_0378 + 18327622-18329826 38 0.012 01_06_1526 + 38003071-38003247,38003338-38003690,38004489-38004987 38 0.012 07_03_1340 + 25887135-25887372,25887676-25887798,25888388-258885... 38 0.016 01_05_0327 + 20984336-20985478 38 0.016 12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 37 0.022 01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 37 0.022 12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682,891... 36 0.038 03_02_0845 - 11700830-11701327 36 0.050 09_04_0406 + 17340129-17340650 36 0.066 05_06_0267 - 26784861-26784896,26785324-26785404,26785530-267857... 35 0.087 01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 35 0.087 01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793,946... 35 0.087 06_03_0949 - 26262993-26263130,26263602-26263670,26263809-26264030 35 0.12 01_06_0406 + 29113033-29113119,29113250-29113309,29114104-291141... 34 0.15 09_04_0594 - 18831011-18831360,18831562-18832111,18832364-188334... 33 0.27 07_03_1417 + 26418131-26418178,26418410-26418502,26418861-264188... 33 0.35 05_04_0027 - 17298727-17299830 33 0.35 03_03_0278 - 16126803-16129049 33 0.46 06_03_0151 + 17270688-17270698,17271149-17271281,17271548-172715... 32 0.81 03_02_0438 + 8470290-8470378,8470900-8470990,8471074-8471134,847... 31 1.4 08_02_0992 + 23380855-23381195,23382464-23382506,23383306-233833... 31 1.9 02_05_0971 - 33188816-33188965,33190406-33190705,33191500-331915... 30 2.5 10_08_1023 - 22341815-22342042,22342179-22342247,22342717-223428... 30 3.3 01_06_0592 + 30465956-30466210,30466401-30466529,30466631-304667... 29 4.3 12_02_1085 - 25935688-25935948,25936589-25936657,25937244-259373... 29 5.7 05_06_0167 - 26104527-26104567,26105130-26105226,26105377-261054... 29 5.7 01_05_0147 + 18597194-18597643,18598347-18598681,18600073-186001... 29 5.7 04_04_1571 + 34504087-34504421,34505002-34505731,34506091-345120... 29 7.6 03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 29 7.6 >03_02_0650 + 10174905-10175000,10175321-10175376,10175467-10175540, 10176215-10176753,10176845-10177186,10177520-10177879, 10177982-10178193,10178881-10179169,10179469-10180152 Length = 883 Score = 51.6 bits (118), Expect = 9e-07 Identities = 25/54 (46%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YKVLG+ A+Q++I + +LS ++HPDK N + AQE+F EI AY+IL Sbjct: 31 YKVLGVDKSASQRDIQKAFHKLSLKYHPDK----NKSKGAQEKFAEINNAYDIL 80 >03_02_0205 + 6389343-6389609,6390418-6390486,6390662-6390757, 6391120-6391244,6391331-6391483,6392863-6392992, 6393122-6393282,6393660-6393702,6393869-6394042, 6394471-6394525,6394567-6394746,6396234-6396339, 6396448-6396506,6397419-6397541,6397825-6397919 Length = 611 Score = 50.4 bits (115), Expect = 2e-06 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 G ++ Y L L +AT QE+ + +R L+R++HPD KD A+E+F EI AYEIL Sbjct: 60 GGKDYYATLNLRRDATLQEVKTAYRTLARKYHPDMNKDP----GAEEKFKEISAAYEIL 114 >02_05_0699 + 31013176-31013345,31013749-31013872,31013950-31014032, 31014106-31014217,31014297-31014401,31014809-31014859, 31015893-31015979,31016325-31016402,31016477-31016530, 31016608-31016892 Length = 382 Score = 50.0 bits (114), Expect = 3e-06 Identities = 24/57 (42%), Positives = 38/57 (66%), Gaps = 3/57 (5%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++ Y+VLG+G AT+QEI S +RR++ ++HPDK D+ A ++F E +Y IL Sbjct: 30 RDPYEVLGVGRNATEQEIKSAFRRMALKYHPDKNADD---PVASDKFQEATFSYNIL 83 >05_01_0207 + 1493224-1493385,1493475-1493839,1494313-1494390, 1496134-1496157,1496213-1496654 Length = 356 Score = 49.6 bits (113), Expect = 4e-06 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YKVLG+G AT +E+ ++RRL+ +HHPDK + + A F ++ +AY++L Sbjct: 6 YKVLGVGRGATDEELKRSYRRLAMKHHPDKNRSPH---ADDSLFKQVSEAYDVL 56 >06_01_0929 - 7171395-7171676,7172019-7172219,7172438-7172524, 7172973-7173023,7173883-7173987,7174074-7174185, 7174284-7174366,7174434-7174557,7174822-7174973 Length = 398 Score = 49.2 bits (112), Expect = 5e-06 Identities = 24/57 (42%), Positives = 37/57 (64%), Gaps = 3/57 (5%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++ Y+VLG+G AT QEI S +RR++ ++HPDK D+ A + F E+ +Y IL Sbjct: 24 RDPYEVLGVGRNATDQEIKSAFRRMALKYHPDKNGDD---PVASDMFQEVTFSYNIL 77 >01_01_0013 + 81507-81932,82718-82864 Length = 190 Score = 48.4 bits (110), Expect = 9e-06 Identities = 21/54 (38%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ E T E+ + +RR++R++HPD V + RF+E+Q+AYE L Sbjct: 56 YDLLGISSEGTLDEVRAAYRRMARKYHPD-VSPPDAAAENTRRFIEVQEAYETL 108 >05_07_0111 - 27752339-27752777,27753356-27753840,27753956-27754120 Length = 362 Score = 48.0 bits (109), Expect = 1e-05 Identities = 19/54 (35%), Positives = 36/54 (66%), Gaps = 2/54 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YK+LG+ A+ ++ +R+L+ + HPD K+ N ++ A+ +F +I +AYE+L Sbjct: 6 YKILGVDKAASDDDLKKAYRKLAMKWHPD--KNPNNKKEAENKFKQISEAYEVL 57 >06_01_0806 - 6048042-6048138,6048461-6048550,6049362-6049425, 6049504-6049552,6050403-6050459,6050953-6051024, 6051912-6052003,6052542-6052614,6052686-6052748, 6052837-6052901,6053803-6053890,6053974-6054015, 6054097-6054188,6054601-6054688,6055134-6055225, 6055368-6055419 Length = 391 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 3/56 (5%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYE 339 E++ YK+LG+ +A+Q+EI + L++ +HPD G AA+ F EI+ AYE Sbjct: 24 EKDYYKILGVPKDASQEEIKRAFHSLAKRYHPD---TNRGNTAAKRTFQEIRDAYE 76 >05_03_0564 - 15502458-15503303,15503394-15503474,15503572-15503620, 15503786-15503828,15504576-15504633,15504720-15504858, 15504980-15505107 Length = 447 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y LG+ A++ EI S +R+L+R +HPD KD A+++F +I AYE+L Sbjct: 92 YSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDP----GAEQKFKDISNAYEVL 141 >05_03_0563 - 15493570-15494415,15494506-15494586,15494684-15494732, 15494898-15494940,15495688-15495745,15495832-15495970, 15496092-15496219 Length = 447 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y LG+ A++ EI S +R+L+R +HPD KD A+++F +I AYE+L Sbjct: 92 YSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDP----GAEQKFKDISNAYEVL 141 >05_03_0562 - 15484733-15485578,15485669-15485749,15485847-15485895, 15486061-15486103,15486851-15486908,15486995-15487133, 15487255-15487382 Length = 447 Score = 47.6 bits (108), Expect = 2e-05 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y LG+ A++ EI S +R+L+R +HPD KD A+++F +I AYE+L Sbjct: 92 YSTLGVSRNASKSEIKSAYRKLARSYHPDVNKDP----GAEQKFKDISNAYEVL 141 >11_01_0725 - 5987706-5988126,5988610-5988902 Length = 237 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Query: 289 KVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 + LG+ P+A +EI + +RRLS+E+HPD R A ERF+ +++AY +L Sbjct: 98 RFLGVEPKADIEEIKAAYRRLSKEYHPDTT--SLPLREASERFIRLREAYNVL 148 >02_05_0821 - 32019775-32019882,32020296-32020352,32020614-32020687, 32021508-32021583,32021796-32021873,32022130-32022228 Length = 163 Score = 46.8 bits (106), Expect = 3e-05 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YK+L +G +A+++ I S++ RL+ + HPDK + G A RF EI +AY++L Sbjct: 36 YKILEVGYDASEEAIRSSYIRLALKWHPDK---KQGEENATSRFQEINEAYQVL 86 >02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559, 5334637-5334730,5334860-5335020,5335114-5335315, 5335619-5335784,5336208-5336286 Length = 446 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YK+LG+ A+ EI +++L+ + HPDK D+ R A+ F EI AYE+L Sbjct: 329 YKILGISKTASAAEIKRAYKKLALQWHPDKNVDK--REEAENMFREIAAAYEVL 380 >03_06_0049 + 31282563-31282841,31283052-31283903,31284109-31284194, 31284544-31284678,31285087-31285252 Length = 505 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/57 (40%), Positives = 36/57 (63%), Gaps = 5/57 (8%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++AY+VLG+G ++ EI +++ RL++E HPD A RF++I AYEIL Sbjct: 44 KSAYEVLGVGETSSSAEIKASFHRLAKETHPDV-----AAAAGSSRFLQILAAYEIL 95 >02_02_0600 + 12018256-12018502,12018943-12019073,12019104-12019553 Length = 275 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/53 (35%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEI 340 YK+L + AT++E+ +R+L+ + HPD K+ N ++ A+ +F +I +AYE+ Sbjct: 6 YKLLQVERGATEEELKKAYRKLAMKWHPD--KNPNSKKEAEAKFKQISEAYEV 56 >01_05_0646 + 23907837-23907956,23908077-23908164,23908282-23908364, 23908487-23908543,23908694-23908939 Length = 197 Score = 45.2 bits (102), Expect = 8e-05 Identities = 23/57 (40%), Positives = 37/57 (64%), Gaps = 5/57 (8%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQE---RFMEIQQAYEIL 341 Y VLG+ P A+ EI + + RL+ + HPDK+ +GR A+E RF ++ +AY++L Sbjct: 17 YAVLGVHPGASAAEIRAAYHRLAMKWHPDKI--TSGRVDAEEAKSRFQQVHEAYQVL 71 >01_01_1211 + 9753518-9753894,9754265-9754313,9754747-9754773 Length = 150 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/63 (34%), Positives = 35/63 (55%), Gaps = 2/63 (3%) Query: 281 PHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDK--VKDENGRRAAQERFMEIQQAY 338 P G+ + Y+ LG+ A++ E+ + + RL+ HHPD+ D R AA RF + AY Sbjct: 3 PGGDGDYYRTLGIERGASKAEVKAAFYRLAPLHHPDRHAASDAAARAAAGGRFRRVYDAY 62 Query: 339 EIL 341 +L Sbjct: 63 TVL 65 >08_01_0408 - 3616655-3617108,3617190-3617596,3618120-3618287 Length = 342 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/54 (33%), Positives = 36/54 (66%), Gaps = 1/54 (1%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VL + AT++++ ++RR++ + HPDK + ++ A+ +F +I +AYE+L Sbjct: 6 YNVLKVNRNATEEDLKKSYRRMAMKWHPDKNPGDK-KKEAEAKFKKISEAYEVL 58 >01_07_0380 + 43181564-43181639,43182053-43182218,43182494-43182695, 43182789-43182949,43183079-43183172,43183250-43183462, 43184917-43185135,43185458-43185661 Length = 444 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YK+LG+ A+ +I +++L+ + HPDK D R A+ F EI AYE+L Sbjct: 328 YKILGISKTASAADIKRAYKKLALQWHPDKNVD--NREEAENMFREIAAAYEVL 379 >02_05_0183 + 26537676-26537752,26538481-26538649,26538736-26538910, 26539008-26539137,26540425-26540558,26540629-26540771, 26540894-26541092,26541183-26541514 Length = 452 Score = 43.6 bits (98), Expect = 2e-04 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 7/54 (12%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VLG+ ATQ E+ +R+ + ++HPDK D E+F E+ QAYE+L Sbjct: 47 YEVLGVSKTATQDELKKAYRKAAIKNHPDKGGD-------PEKFKELAQAYEVL 93 >01_01_0976 + 7711634-7711801,7712741-7713183,7715813-7716251 Length = 349 Score = 43.6 bits (98), Expect = 2e-04 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YKVLG+ A ++ + +L+ HPDK N ++ A+ +F +I +AYE+L Sbjct: 6 YKVLGVDRGAGDDDLKKAYHKLAMRWHPDK-NPTNNKKEAEAKFKQISEAYEVL 58 >08_02_1300 + 25972496-25972582,25972664-25972723,25973786-25973868, 25974120-25974166,25975194-25975352,25975466-25975644, 25975738-25975818,25975903-25976046,25976246-25976347 Length = 313 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 E Y VLG+ P AT+ EI + +R+ HPD K+ N +AA E F + +AY++L Sbjct: 4 ETGYYDVLGVSPTATESEIKKAYYMKARQVHPD--KNPNDPKAA-ENFQALGEAYQVL 58 >06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-927313, 927826-927897,928145-928236,928331-928403,928870-928944, 929207-929314,929372-929422,929834-929959,930324-930362, 930452-930535,931018-931109,931217-931300,931410-931524 Length = 415 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Query: 281 PHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEI 340 P ++ Y VLG+ A+Q EI + L+++ HPD K G A+ +F E+Q+AYE Sbjct: 70 PVAARDYYDVLGVSRNASQGEIKKAYYALAKKLHPDTNK---GDSDAERKFQEVQRAYET 126 Query: 341 L 341 L Sbjct: 127 L 127 >03_02_0704 - 10542187-10542339,10542466-10542522,10542667-10542737, 10542823-10542901,10543021-10543161 Length = 166 Score = 43.2 bits (97), Expect = 3e-04 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 2/54 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ A+ ++ + +RRL+ + HPD+ + G A RF IQ+AY +L Sbjct: 24 YSLLGIRKNASATDVRAAYRRLAMKWHPDRCVSDPGE--ANRRFQRIQEAYSVL 75 >04_03_0283 + 13887388-13887573,13887711-13887806,13888517-13888637, 13888734-13888840,13888949-13889166,13890219-13890396, 13890492-13890611,13891601-13891687,13892401-13892511, 13892618-13893439 Length = 681 Score = 42.7 bits (96), Expect = 4e-04 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 5/55 (9%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFME-IQQAYEIL 341 Y +LGL P A++ +I ++RRLS ++HPDK D A + F+E I +AY+ L Sbjct: 101 YSILGLEPGASESDIKKSYRRLSIQYHPDKNPDPE----AHKYFVEFISKAYQAL 151 >12_01_0438 + 3455686-3455692,3456149-3456240,3457422-3457505, 3457598-3457636,3457952-3458041,3458567-3458611, 3458702-3458789,3458902-3458966,3459063-3459137, 3460231-3460303,3460708-3460799,3460896-3460967, 3461165-3461221,3461316-3461364,3461522-3461610 Length = 338 Score = 42.3 bits (95), Expect = 6e-04 Identities = 19/54 (35%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VLG+ +A+ +I + L+++ HPD K++ A+++F E+Q AYE+L Sbjct: 13 YDVLGVNKDASASDIKKAYYLLAKKFHPDTNKED---ADAEKKFQEVQHAYEVL 63 >08_02_0469 - 17531189-17531678,17531773-17531798,17533511-17533669 Length = 224 Score = 41.9 bits (94), Expect = 8e-04 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEI 340 Y++L + AT +I +RRL+ HPD K+ G++ A+ +F +I +AY I Sbjct: 4 YEILHVDRSATDDDIRRAYRRLAMRWHPD--KNHTGKKDAEAKFKDITEAYNI 54 >06_01_0667 + 4878784-4878900,4879016-4879118,4879256-4879341, 4879434-4879496,4879589-4879831,4880639-4880728, 4881403-4881600 Length = 299 Score = 41.9 bits (94), Expect = 8e-04 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 6/64 (9%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRA------AQERFMEIQQA 337 + + Y VLGL E T ++ +R+L+ HPD+ G + A+ERF EIQ A Sbjct: 12 DADLYAVLGLSRECTDADLRLAYRKLAMIWHPDRCSVAGGSASAAGVDEAKERFQEIQGA 71 Query: 338 YEIL 341 Y +L Sbjct: 72 YSVL 75 >02_01_0225 - 1469295-1469733,1472352-1472767,1473603-1473658, 1473827-1473995 Length = 359 Score = 41.5 bits (93), Expect = 0.001 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYE 339 Y +L + AT +++ ++RRL+R HPD K+ G A+ +F +I +AYE Sbjct: 6 YNILKVNRNATLEDLKKSYRRLARTWHPD--KNPTGGAEAEAKFKQITEAYE 55 >03_06_0226 + 32495088-32495237,32496189-32496351,32496438-32496576, 32496669-32496945,32497051-32497249,32497379-32497704 Length = 417 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 7/54 (12%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VLG+ +A+Q ++ +R+ + ++HPDK D E+F E+ QAYE+L Sbjct: 15 YEVLGVPKDASQDDLKKAYRKAAIKNHPDKGGD-------PEKFKELAQAYEVL 61 >02_01_0717 + 5351504-5351602,5353401-5353499,5353574-5353675, 5353756-5353815,5353900-5354006,5354114-5354196, 5354372-5354462,5354561-5354768 Length = 282 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 3/57 (5%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++ Y++LG+ A+QQEI + +L+ HPDK G A+E+F ++Q+ IL Sbjct: 29 KSLYEILGVERTASQQEIKKAYHKLALRLHPDK---NPGDEEAKEKFQQLQKVISIL 82 >05_01_0411 + 3243025-3243092,3243348-3243496,3243740-3243872, 3244740-3244860,3245065-3245181,3245303-3245389, 3245941-3246000,3246097-3246174,3246587-3246658, 3246767-3246925 Length = 347 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VL + A++ +I ++R+L+ ++HPDK A +RF EI AYEIL Sbjct: 27 YDVLQVPKGASEDQIKRSYRKLALKYHPDK---NPNNEEANKRFAEINNAYEIL 77 >02_05_0381 - 28483425-28483458,28483588-28483658,28483746-28483819, 28483975-28484050,28484129-28484206,28485557-28485589 Length = 121 Score = 40.7 bits (91), Expect = 0.002 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 5/61 (8%) Query: 281 PHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEI 340 PH ++ YKVL + +A+ I ++RRL+ HPDK K +N A +F EI +AY + Sbjct: 9 PH--KDYYKVLEVDYDASDDTIKLSYRRLALMWHPDKHKGDNDVTA---KFQEINEAYTV 63 Query: 341 L 341 L Sbjct: 64 L 64 >09_03_0078 + 12137124-12137672 Length = 182 Score = 40.3 bits (90), Expect = 0.002 Identities = 25/62 (40%), Positives = 35/62 (56%), Gaps = 5/62 (8%) Query: 283 GEQNAYKVLGL--GPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQER-FMEIQQAYE 339 GE + YKVL L E +EI +RRL+ +HPD RRA R F+++++AYE Sbjct: 51 GEDDYYKVLSLDRAGEVGAEEIRRAYRRLALRYHPDACPP--SRRAESTRLFLQLRRAYE 108 Query: 340 IL 341 L Sbjct: 109 TL 110 >05_04_0387 - 20834510-20834978,20836866-20837329,20837458-20837634 Length = 369 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y++L + + + +EI + ++ L R+ HPDK + + A+ RF I +AYE L Sbjct: 9 YRILNISRDTSPKEIRAAYKTLVRQWHPDK-HPPSSKNEAEARFKAITEAYEAL 61 >04_04_0712 + 27476319-27476569,27477150-27477402,27477535-27477914, 27479738-27479864,27479945-27480110,27480221-27480359, 27481854-27481987,27482087-27482229,27482367-27482565, 27482688-27483010 Length = 704 Score = 39.9 bits (89), Expect = 0.003 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 7/54 (12%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VLG+ A++ E+ +R+ + ++HPDK D E+F E+ QAYE+L Sbjct: 302 YEVLGVPKTASKDELKKAYRKAAIKNHPDKGGD-------PEKFKELSQAYEVL 348 >08_02_0878 + 22152437-22152532,22152619-22152718,22152907-22152974, 22153085-22153141,22153243-22153350,22153888-22153971 Length = 170 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 5/59 (8%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKV-----KDENGRRAAQERFMEIQQAYEIL 341 Y VLG+ + + ++ + +R+L+ + HPDK G AA+ RF +IQ AY +L Sbjct: 9 YAVLGVASDCSDADLRTAYRKLAMKWHPDKCGAAGSSAGGGAEAAKVRFQKIQGAYAVL 67 >03_05_0497 + 24932336-24932485,24934037-24934199,24934306-24934447, 24934528-24934804,24934887-24935085,24935169-24935491 Length = 417 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 7/54 (12%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y++LG+ A+Q ++ +R+ + ++HPDK D E+F E+ QAYE+L Sbjct: 15 YEILGVPKTASQDDLKKAYRKAAIKNHPDKGGD-------PEKFKELAQAYEVL 61 >08_02_1491 + 27500532-27500972 Length = 146 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/54 (40%), Positives = 29/54 (53%), Gaps = 5/54 (9%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VLGL AT +EI + +RRL+RE HPD A + F+ + AY L Sbjct: 46 YDVLGLRAGATVREIKAAYRRLARERHPDVAAS-----AGADDFVRLHDAYATL 94 >04_03_0735 + 19141038-19143227 Length = 729 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 4/59 (6%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 GE + Y++L L A ++E+ +R+L+ + HPDK N A+E F I +A+ +L Sbjct: 59 GESDWYRILSLTAFADEEEVKKQYRKLALQLHPDK----NKSVGAEEAFKLISEAWSVL 113 >02_04_0220 - 21014225-21014386,21014492-21014572,21014739-21014938, 21014999-21015157,21015248-21015377,21015520-21015673, 21015785-21015867,21015981-21016040,21016131-21016217 Length = 371 Score = 39.1 bits (87), Expect = 0.005 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 E Y VLG+ P A+ EI + +R+ HPD K+ N +AA E+F + +AY++L Sbjct: 4 ETEFYDVLGVCPAASDDEIRKAYYIKARQVHPD--KNPNDPQAA-EKFQALGEAYQVL 58 >12_02_0454 + 19199063-19200757,19202201-19202287 Length = 593 Score = 38.7 bits (86), Expect = 0.007 Identities = 19/54 (35%), Positives = 30/54 (55%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VLG+ + + +I +RRL+ HPDK + AA F E+Q A+ +L Sbjct: 12 YEVLGVPRDCSPADIKLAFRRLALSLHPDKQPPGSDVAAATAAFQELQHAHSVL 65 >10_08_0580 - 18912364-18912420,18912524-18912631,18912973-18913212, 18913809-18913886,18914063-18914143,18914354-18914407, 18920402-18920545 Length = 253 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/44 (34%), Positives = 27/44 (61%) Query: 280 DPHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENG 323 +P + Y +L L P+A+ +EI +R+ ++ +HPDK +D G Sbjct: 6 EPEDGRELYALLHLSPDASGEEIRRAYRQYAQIYHPDKYQDPQG 49 >06_03_1400 + 29901835-29902136,29902913-29902934 Length = 107 Score = 37.9 bits (84), Expect = 0.012 Identities = 16/29 (55%), Positives = 23/29 (79%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPD 316 Y+VLG+G A++ EI + +RRL+RE HPD Sbjct: 46 YEVLGVGAGASRGEIKAAYRRLAREVHPD 74 >02_03_0378 + 18327622-18329826 Length = 734 Score = 37.9 bits (84), Expect = 0.012 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 GE + Y++L L A ++E+ +R+L+ + HPDK N A+ F I +A+ +L Sbjct: 69 GENDWYRILSLSASADEEEVKKQYRKLALQLHPDK----NKSVGAEGAFKLISEAWAVL 123 >01_06_1526 + 38003071-38003247,38003338-38003690,38004489-38004987 Length = 342 Score = 37.9 bits (84), Expect = 0.012 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +++L + E + QEI + ++ L ++ HPDK + + A+ RF I +AYE L Sbjct: 9 HRILNIPRETSPQEIRAAYKSLVKKWHPDK-HPPSSKPEAEARFKAITEAYEAL 61 >07_03_1340 + 25887135-25887372,25887676-25887798,25888388-25888527, 25888680-25888817,25888898-25889119 Length = 286 Score = 37.5 bits (83), Expect = 0.016 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 5/53 (9%) Query: 293 LGPEATQQEITSTWRRLSREHHPDKVKDENGR----RAAQERFMEIQQAYEIL 341 L +A ++ I + +RRL++ +HPD V D G A+ RF++IQ AYE+L Sbjct: 97 LDRDADEETIKTAYRRLAKFYHPD-VYDGKGTLEEGETAEARFIKIQAAYELL 148 >01_05_0327 + 20984336-20985478 Length = 380 Score = 37.5 bits (83), Expect = 0.016 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y++LGL + T +++ +R+LS + HPDK N A++ F + +A++ L Sbjct: 132 YQILGLEKDCTVEDVRKAYRKLSLKVHPDK----NKAPGAEDAFKAVSKAFQCL 181 >12_02_1140 + 26411424-26411998,26412491-26412761,26412848-26413405 Length = 467 Score = 37.1 bits (82), Expect = 0.022 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ A EI +RR + HHPDK DE E F E+ +AY++L Sbjct: 14 YDLLGVPRGADGDEIRRAYRRAAVTHHPDKGGDE-------EAFKEVARAYQVL 60 >01_01_1212 + 9763949-9764412,9765183-9765252,9765356-9765457 Length = 211 Score = 37.1 bits (82), Expect = 0.022 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDK---VKDENGRRAAQERFMEIQQAYEIL 341 Y+ LGL +AT+ E+ + +RR + HPD+ D R A RF AY +L Sbjct: 6 YQTLGLRQDATKAEVKAAFRRRALRDHPDRHAHSPDAAARADAARRFRLASDAYRVL 62 >12_01_0915 - 8908643-8908756,8909086-8909203,8909570-8909682, 8911138-8911218,8911307-8911357,8912173-8912232, 8913353-8913419,8913509-8913759 Length = 284 Score = 36.3 bits (80), Expect = 0.038 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 4/46 (8%) Query: 296 EATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +A EI + +LS +HHPDK D R+ F++I AYEIL Sbjct: 67 DANVSEIKKAYYKLSLKHHPDKNPDPESRKL----FVKIANAYEIL 108 >03_02_0845 - 11700830-11701327 Length = 165 Score = 35.9 bits (79), Expect = 0.050 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 6/54 (11%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VL + A +EI + +RR +R HPD ERFM ++AYE+L Sbjct: 56 YEVLAVEETAGAEEIKAAYRRAARRWHPDACP------GGAERFMLAREAYEVL 103 >09_04_0406 + 17340129-17340650 Length = 173 Score = 35.5 bits (78), Expect = 0.066 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 3/61 (4%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDE-NGRRAAQER--FMEIQQAYEI 340 ++ Y+VL + +AT EI + ++ HPDK + N ++ ER F+ +Q+A+EI Sbjct: 10 QETLYEVLSVRKDATYDEIRAAYKSAVLNTHPDKAQMALNPLVSSSERNEFLSVQKAWEI 69 Query: 341 L 341 L Sbjct: 70 L 70 >05_06_0267 - 26784861-26784896,26785324-26785404,26785530-26785702, 26785780-26785938,26786199-26786328,26786447-26786609, 26787027-26787109,26787605-26787664,26787819-26787940, 26789126-26789275,26789354-26789546,26790156-26790393, 26791240-26791320,26791403-26791647 Length = 637 Score = 35.1 bits (77), Expect = 0.087 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y LG+ +A+ EI + +++ HPDK G A ++F E+ +AY++L Sbjct: 322 YDTLGVSVDASPAEIKKAYYLKAKQVHPDK---NPGNPDAAQKFQELGEAYQVL 372 >01_07_0010 + 40429613-40429677,40429702-40430015,40432150-40434386 Length = 871 Score = 35.1 bits (77), Expect = 0.087 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 GE + Y +L + ++I +R+L+ + HPDK N A+ F IQ A+++L Sbjct: 190 GENDLYGILDISASDDDEKIKKQYRKLALQTHPDK----NKFSGAESAFKLIQDAWDVL 244 >01_01_1190 + 9463973-9465732,9466210-9466440,9467664-9467793, 9468723-9468888,9469528-9469859,9470284-9470513, 9471535-9471613,9471689-9471865 Length = 1034 Score = 35.1 bits (77), Expect = 0.087 Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 286 NAYKVLGLGPEATQQEITSTWRRLSREHHPDK 317 N Y +LG+ P T +I +R+ + HHPDK Sbjct: 945 NVYLILGIEPSCTFLDIKKAYRKAALRHHPDK 976 >06_03_0949 - 26262993-26263130,26263602-26263670,26263809-26264030 Length = 142 Score = 34.7 bits (76), Expect = 0.12 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 4/57 (7%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++ Y+ L L P AT+ E+ +RRL+ +HPD K+ + + F I AY+++ Sbjct: 47 EDHYRTLRLPPGATKGEVKRAFRRLALTYHPDVSKESD----SGVHFQRINVAYQMV 99 >01_06_0406 + 29113033-29113119,29113250-29113309,29114104-29114186, 29114394-29114556,29114695-29114824,29115016-29115174, 29115295-29115464,29115590-29115670,29116492-29116536, 29116597-29117346,29117424-29117654 Length = 652 Score = 34.3 bits (75), Expect = 0.15 Identities = 19/54 (35%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VLG+ +A+ EI + ++ HPDK A+ RF E+ +AY+IL Sbjct: 8 YDVLGVSTDASAAEIKKAYYLKAKLVHPDK---NPNNPDAERRFKELGEAYQIL 58 >09_04_0594 - 18831011-18831360,18831562-18832111,18832364-18833406, 18833496-18833760,18835194-18835340,18835431-18835511, 18835626-18835804,18835935-18836093,18836269-18836398, 18836935-18837094,18837337-18837419,18837865-18837915, 18838035-18838151,18838273-18838359 Length = 1133 Score = 33.5 bits (73), Expect = 0.27 Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDK 317 E Y VLG+ P AT+ EI + +R+ HPDK Sbjct: 4 ETGYYDVLGVSPTATEVEIKKAYYMKARKVHPDK 37 >07_03_1417 + 26418131-26418178,26418410-26418502,26418861-26418891, 26419011-26419037,26419115-26419235,26419320-26419374 Length = 124 Score = 33.1 bits (72), Expect = 0.35 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 301 EITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 E+ + +RR+ E HPD+V + A+ +F +I +AY L Sbjct: 16 EVKAAYRRMVMESHPDRVPTHQ-KSQAESKFKQISEAYSCL 55 >05_04_0027 - 17298727-17299830 Length = 367 Score = 33.1 bits (72), Expect = 0.35 Identities = 17/54 (31%), Positives = 30/54 (55%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ + +EI +R+LS + HPDK N A++ F + +A++ L Sbjct: 108 YAILGVERSCSVEEIRKAYRKLSLKVHPDK----NKAPGAEDAFKLVSKAFKCL 157 >03_03_0278 - 16126803-16129049 Length = 748 Score = 32.7 bits (71), Expect = 0.46 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 GE++ Y +L + A + + +R+L + HPDK N A+ F +Q+A+ +L Sbjct: 63 GEKDWYSILSVESSADDETLKKQYRKLVLQLHPDK----NKSVGAEGAFKMVQEAWTVL 117 >06_03_0151 + 17270688-17270698,17271149-17271281,17271548-17271589, 17271706-17271815,17271957-17272035,17272114-17272287, 17272386-17272466,17272761-17272988,17273067-17273402, 17273501-17273586,17273642-17273783,17274596-17274687, 17274770-17274904,17275142-17275304,17275393-17275482, 17275568-17275753,17276109-17276141,17276700-17276762, 17276839-17276901,17276983-17277042,17277258-17277410, 17277530-17277613,17278434-17278610,17278685-17278791, 17278858-17279071,17279158-17279261,17279926-17280061, 17280191-17280316,17280682-17280792,17280968-17281066, 17281367-17281633,17281707-17281822,17281853-17282084, 17282597-17282664,17282682-17282807,17282980-17283040 Length = 1495 Score = 31.9 bits (69), Expect = 0.81 Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHH 314 ++ Y+VLG+ +T QEI +R+L + HH Sbjct: 1439 EDYYQVLGVTVNSTPQEIKEAYRKLQKRHH 1468 >03_02_0438 + 8470290-8470378,8470900-8470990,8471074-8471134, 8471678-8471755,8471891-8471964,8472689-8472802, 8472881-8472988,8473937-8473975,8474046-8474132 Length = 246 Score = 31.1 bits (67), Expect = 1.4 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 4/56 (7%) Query: 286 NAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 N ++ L L +++ E+ +R+LS HPDK K AQE F + +A ++L Sbjct: 38 NPFEHLKLSFDSSADEVKKQYRKLSLLVHPDKCKHPK----AQEAFAALAKAQQLL 89 >08_02_0992 + 23380855-23381195,23382464-23382506,23383306-23383371, 23384228-23384428,23384450-23384707,23384798-23385013, 23385148-23385321,23386151-23386312,23386594-23386635 Length = 500 Score = 30.7 bits (66), Expect = 1.9 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVK---DENGRRAAQERFMEIQQAYEI 340 ++ Y+VL + AT E+ + +R HPDK + D F +Q+A+E+ Sbjct: 10 QKTHYEVLSVNEGATYDEVRAGYRAAILNAHPDKSQAKLDSLVSSVEHGEFFSVQKAWEV 69 Query: 341 L 341 L Sbjct: 70 L 70 >02_05_0971 - 33188816-33188965,33190406-33190705,33191500-33191562, 33191637-33191710,33191880-33191973,33193396-33193482, 33193753-33193887 Length = 300 Score = 30.3 bits (65), Expect = 2.5 Identities = 20/64 (31%), Positives = 27/64 (42%), Gaps = 10/64 (15%) Query: 281 PHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRR---AAQERFMEIQQA 337 P ++ YKV L T W HPDK + + A+E+F EIQ A Sbjct: 51 PLQQKANYKVCDLSKAGTAATFNERW-------HPDKCSSSSSAKHMEEAKEKFQEIQGA 103 Query: 338 YEIL 341 Y +L Sbjct: 104 YSVL 107 >10_08_1023 - 22341815-22342042,22342179-22342247,22342717-22342840, 22343193-22343317,22343815-22344276,22344357-22344700, 22345061-22345406,22345492-22345941,22346760-22347051, 22347171-22347515,22347611-22347834,22348072-22348563, 22348664-22349056,22349601-22349741,22349845-22350207, 22350494-22352683,22353298-22353360,22353434-22353535, 22353672-22354027,22354326-22354413,22354517-22354750, 22355508-22355975 Length = 2632 Score = 29.9 bits (64), Expect = 3.3 Identities = 15/43 (34%), Positives = 29/43 (67%), Gaps = 6/43 (13%) Query: 299 QQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++++ +R+L+ ++HPD K+ GR E+F+ +Q+AYE L Sbjct: 1593 EEKLKRQYRKLAIKYHPD--KNPEGR----EKFVAVQKAYERL 1629 >01_06_0592 + 30465956-30466210,30466401-30466529,30466631-30466760, 30466861-30466981,30467111-30467192,30467334-30467384, 30467836-30467929,30468046-30468173 Length = 329 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPD 316 ++ Y VLG+ P+AT Q+I + + HPD Sbjct: 77 EDYYAVLGVMPDATPQQIKKAYYNCMKACHPD 108 >12_02_1085 - 25935688-25935948,25936589-25936657,25937244-25937315, 25937693-25937791,25937927-25938007,25938099-25938586, 25938728-25938857,25939994-25940239 Length = 481 Score = 29.1 bits (62), Expect = 5.7 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 5/56 (8%) Query: 288 YKVLGLGPEAT--QQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VLG+ + Q+ + + R+ HPDK G A E F ++Q AYE+L Sbjct: 265 YEVLGIPRNRSIDQKILKKEYHRMVLLVHPDK---NMGNPLACESFKKLQSAYEVL 317 >05_06_0167 - 26104527-26104567,26105130-26105226,26105377-26105415, 26105628-26105678,26105978-26106059,26106222-26106282, 26106380-26106509,26106630-26106758,26107057-26107314 Length = 295 Score = 29.1 bits (62), Expect = 5.7 Identities = 12/29 (41%), Positives = 17/29 (58%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPD 316 Y VLG+ P+AT +EI + + HPD Sbjct: 81 YSVLGVMPDATPEEIKKAYYSCMKACHPD 109 >01_05_0147 + 18597194-18597643,18598347-18598681,18600073-18600147, 18600325-18600427,18601554-18601642,18602953-18603064, 18604093-18604146,18604271-18604319,18606236-18606347, 18606389-18606436,18607000-18607327 Length = 584 Score = 29.1 bits (62), Expect = 5.7 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 E + Y V+G+ + + I + +LS HPDK +AQE F+++ A++ L Sbjct: 330 ENSPYDVVGINWKMSSDNIKKRYWKLSLLVHPDKCP----HPSAQEAFVKLNNAFKDL 383 >04_04_1571 + 34504087-34504421,34505002-34505731,34506091-34512077, 34512493-34513964,34514114-34514377,34514761-34514978, 34515759-34516030,34516190-34516559,34516578-34516797, 34516819-34518931,34518941-34519193,34519269-34519401, 34520597-34521114,34521207-34522115,34522195-34522368, 34522833-34522882,34523963-34524035,34524413-34524477, 34524736-34525522,34525622-34525878,34525989-34526109, 34526315-34526956 Length = 5320 Score = 28.7 bits (61), Expect = 7.6 Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPD 316 E + Y +LG+ + Q EI + +R L + HPD Sbjct: 4918 EYDLYGLLGVERSSPQSEIKAAYRSLQKRCHPD 4950 >03_06_0554 + 34691050-34691242,34691327-34691394,34691754-34692275 Length = 260 Score = 28.7 bits (61), Expect = 7.6 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VL + AT+ + +R+L+ + HPDK N A+ F + +A+ L Sbjct: 43 YLVLAVADAATEDAVRRRYRQLALQLHPDK----NTHAKAEVAFKIVSEAHACL 92 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.326 0.141 0.470 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,733,547 Number of Sequences: 37544 Number of extensions: 461074 Number of successful extensions: 1180 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 14 Number of HSP's that attempted gapping in prelim test: 1088 Number of HSP's gapped (non-prelim): 77 length of query: 358 length of database: 14,793,348 effective HSP length: 83 effective length of query: 275 effective length of database: 11,677,196 effective search space: 3211228900 effective search space used: 3211228900 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -