BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000608-TA|BGIBMGA000608-PA|IPR001623|Heat shock protein DnaJ, N-terminal (358 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 265 3e-71 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 52 5e-07 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 5e-06 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 46 5e-05 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 6e-05 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 46 6e-05 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 46 6e-05 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 45 8e-05 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 45 8e-05 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 44 3e-04 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 44 3e-04 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 3e-04 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 43 4e-04 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 42 8e-04 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 41 0.001 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 41 0.001 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 39 0.005 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 39 0.005 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 39 0.005 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.051 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 36 0.051 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 35 0.088 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 35 0.088 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 35 0.12 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.15 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 34 0.20 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.82 SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.4 SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) 29 4.4 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 265 bits (650), Expect = 3e-71 Identities = 134/339 (39%), Positives = 199/339 (58%), Gaps = 12/339 (3%) Query: 7 KKSIFLAYIFWLFGGPFGVHHFYLRRDRHAFVWWTTLGG-FGIGWLGEVFRIPRYVRDAN 65 KKS+ L YI W G G+HHFYL RD AFVWW+T GG FG+GWL +++RIP YV DAN Sbjct: 517 KKSLLLTYIIWFKLGWLGLHHFYLGRDIQAFVWWSTFGGVFGLGWLRDLWRIPEYVEDAN 576 Query: 66 EDPKYVEDLIGRMIRNKKPPFSMNRFTGMLMVGYSWGQMMMVAVP-SDEIWGINFRYLNY 124 ED Y+E+L ++ K+PPFS RF G ++VGY +G + +A+P S W Sbjct: 577 EDHYYIEELKRKIKLRKEPPFSTTRFAGQMLVGYFYGILTRLAIPESAPKWTPAL----- 631 Query: 125 LIPLVAALGVWTVGNIGHEQGTLKWPLLAAYVSYPLRYFIYDETVFFTIMVLSAALAFDS 184 +PL A G++ VGNIG E+G K+ L+ VSY FI + + L A+ F Sbjct: 632 WVPLAVASGIYLVGNIGRERGDFKYALIGCLVSYASITFINGDEAGNMYVALFGAMLFQ- 690 Query: 185 FSKQWRRTPRRHR--FVKRVIVLGVCAXXXXXXXXXXXXFNGTITDSEGDEVPIYEALHH 242 + +++R+ ++ + +RV VL + FN +T +G+ + + +A++H Sbjct: 691 YKREYRKEIKQEKRSLCRRVQVLALGGLIMCALWGSFIYFNAEVTTEDGETIKLRDAVNH 750 Query: 243 FFTSPWWLDVKQCLIDTYQYAQHHGWYEVWKQIIDLSDPHGEQNAYKVLGLGPEATQQEI 302 FF SP WL+ K L Y Q +GW ++ + DP GE+N+Y+VLGL +ATQ+EI Sbjct: 751 FFNSPVWLEFKDVLWQLYDEGQKNGWQNLYDDFVKALDPRGEKNSYRVLGLTEDATQEEI 810 Query: 303 TSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +++L+ + HPD+ +D + AQ+ FMEIQ+AYEIL Sbjct: 811 KKRYKKLAMKWHPDRHRD--NKEEAQKHFMEIQEAYEIL 847 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 53.2 bits (122), Expect = 3e-07 Identities = 23/54 (42%), Positives = 37/54 (68%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 YK+LG+ P A Q+EI + L++++HPD KD ++A E+F E+ +AYE+L Sbjct: 61 YKILGVPPNANQKEIKKAYFELAKKYHPDTNKD----KSASEKFQEVSEAYEVL 110 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 4/71 (5%) Query: 271 VWKQIIDLSDPHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQER 330 VW + + P ++N Y VLG+ P+A+Q +I + +LS +HHPD+ G E Sbjct: 58 VWSRCY-ANKPGSKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDR---HQGSDKKHEV 113 Query: 331 FMEIQQAYEIL 341 F EI +AY +L Sbjct: 114 FQEIAEAYSVL 124 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 52.4 bits (120), Expect = 5e-07 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 4/71 (5%) Query: 271 VWKQIIDLSDPHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQER 330 VW + + P ++N Y VLG+ P+A+Q +I + +LS +HHPD+ G E Sbjct: 58 VWSRCY-ANKPGSKKNYYNVLGVSPKASQSKIKDAYYKLSMKHHPDR---HQGSDKKHEV 113 Query: 331 FMEIQQAYEIL 341 F EI +AY +L Sbjct: 114 FQEIAEAYSVL 124 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 49.2 bits (112), Expect = 5e-06 Identities = 22/57 (38%), Positives = 38/57 (66%), Gaps = 4/57 (7%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +N Y +LG+ +A+ QE+ +++ + ++HPDK KD A+E+F EI +AYE+L Sbjct: 3 KNYYDILGVKKDASDQELKKAYKKQAFKYHPDKNKDP----GAEEKFKEIAEAYEVL 55 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 6/54 (11%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +L + P AT EI ++R+L+ ++HPDK DE +RF +I QAYE+L Sbjct: 67 YDILNVPPTATATEIKKSYRKLALKYHPDKNPDEG------DRFKQISQAYEVL 114 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 47.2 bits (107), Expect = 2e-05 Identities = 23/58 (39%), Positives = 34/58 (58%), Gaps = 6/58 (10%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 E N Y+VLG+ AT +I +RRL+ ++HPDK +E F E+ +AYE+L Sbjct: 2 ESNYYEVLGVERNATTDDIRRAYRRLALKYHPDK------NAGTEENFKEVSEAYEVL 53 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 46.4 bits (105), Expect = 4e-05 Identities = 21/58 (36%), Positives = 39/58 (67%), Gaps = 1/58 (1%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +++ YK+LGL ++EIT +R+L+ + HPD K E+ ++ A++ F++I A E+L Sbjct: 206 KRDYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGED-KKKAEKMFIDIAAAKEVL 262 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 46.0 bits (104), Expect = 5e-05 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 5/76 (6%) Query: 266 HGWYEVWKQIIDLSDPHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRR 325 H W V ++ D+ + + N Y+VLG+ ATQ EI +RR+S + HPD+ K+++ Sbjct: 2464 HAWDSVDLELFDIVE-EVKDNFYQVLGVETTATQAEIRRAYRRISLQLHPDRNKEDD--- 2519 Query: 326 AAQERFMEIQQAYEIL 341 A+ +F ++ E+L Sbjct: 2520 -AELKFRKLVAVAEVL 2534 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 4/57 (7%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +N Y V+ L P ATQ+EI S + LSR +HPD N A+ERF E+ AY L Sbjct: 50 KNHYDVMKLLPTATQREIKSAYYELSRIYHPDL----NSSAEARERFAELTLAYNTL 102 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 45.6 bits (103), Expect = 6e-05 Identities = 22/54 (40%), Positives = 36/54 (66%), Gaps = 3/54 (5%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ +A++ +I +R+L+ + HPDK KD+ AQE+F +I AYE+L Sbjct: 27 YAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDD---PKAQEKFHDIGAAYEVL 77 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 45.6 bits (103), Expect = 6e-05 Identities = 26/57 (45%), Positives = 33/57 (57%), Gaps = 4/57 (7%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +N Y V+ L P ATQ+EI S + LSR +HPD N A+ERF E+ AY L Sbjct: 197 KNHYDVMKLLPTATQREIKSAYYELSRIYHPDL----NSSAEARERFAELTLAYNTL 249 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/54 (35%), Positives = 38/54 (70%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y++LG+ A+ ++I +R+++ ++HPDK K ++ A+E+F E+ +AYE+L Sbjct: 28 YQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKD----AEEKFREVAEAYEVL 77 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 45.2 bits (102), Expect = 8e-05 Identities = 19/57 (33%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++ Y+VLG+ A+++++ +RR + HPD K+ R A+E+F ++ +AYE+L Sbjct: 3 EDYYEVLGVPRSASEEDVKKAYRRQALRWHPD--KNPTNREHAEEKFKKLSEAYEVL 57 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 4/57 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDK---VKDENGRRAAQERFMEIQQAYEIL 341 YK+L + A++ EI +++ + +HHPD+ DE ++ A+++F E+ +AY IL Sbjct: 161 YKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQ-KKIAEKQFKEVNEAYSIL 216 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/57 (33%), Positives = 36/57 (63%), Gaps = 4/57 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDK---VKDENGRRAAQERFMEIQQAYEIL 341 YK+L + A++ EI +++ + +HHPD+ DE ++ A+++F E+ +AY IL Sbjct: 161 YKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQ-KKIAEKQFKEVNEAYSIL 216 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 43.6 bits (98), Expect = 3e-04 Identities = 19/54 (35%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +L + A++Q+I ++R+L+ + HPD K+ + A+ +F EI +AYE+L Sbjct: 5 YDILEVPRSASEQDIKKSYRKLALKWHPD--KNPQNKEEAERKFKEISEAYEVL 56 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 43.6 bits (98), Expect = 3e-04 Identities = 20/59 (33%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 G +N Y VLG+ A++ EI +R++S + HPD+ D+ + A +F + ++Y IL Sbjct: 12 GVKNLYDVLGVSKTASESEIKRAYRKISLQVHPDRA-DKGEKEKATRKFQALSKSYCIL 69 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 +N Y +LG+ A+ +I +RR + HPDK N A+E+F EI +AY++L Sbjct: 3 RNYYAILGVPRNASDDDIKKAYRRQALIFHPDK----NKNSGAEEKFKEISEAYKVL 55 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 41.9 bits (94), Expect = 8e-04 Identities = 20/54 (37%), Positives = 33/54 (61%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LGL AT +I +R+LS ++HPDK N +A+ +F + +AY++L Sbjct: 6 YDILGLTRSATDADIKKEYRKLSLKYHPDK----NQEPSAEVKFRQAAEAYDVL 55 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 4/54 (7%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y VL + A+ +I +R+ + ++HPDK N A+E+F EI +AYE+L Sbjct: 6 YAVLNVDKAASADDIKKAYRKQALKYHPDK----NKSPGAEEKFKEISEAYEVL 55 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 41.1 bits (92), Expect = 0.001 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 4/61 (6%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDE----NGRRAAQERFMEIQQAYEI 340 ++A VLG+ P I +R+L EHHPDK+ + A+++ EIQQAYE+ Sbjct: 74 EDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYEL 133 Query: 341 L 341 + Sbjct: 134 I 134 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 40.7 bits (91), Expect = 0.002 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 2/54 (3%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y+VLG+ + + T+R+L+ + HPDK D N + + F EIQQAY++L Sbjct: 6 YEVLGVERDVDDSALKKTYRKLALKWHPDKNLD-NAEESTRV-FREIQQAYDVL 57 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ A+ +I +R+L++E HPDK D E+F +I AYEIL Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTG------EKFKDITFAYEIL 54 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 39.1 bits (87), Expect = 0.005 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 6/54 (11%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 Y +LG+ A+ +I +R+L++E HPDK D E+F +I AYEIL Sbjct: 7 YDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTG------EKFKDITFAYEIL 54 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/59 (33%), Positives = 34/59 (57%), Gaps = 3/59 (5%) Query: 283 GEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 G +N Y LG+ ++T++EI +R+ + + HPDK D A E F ++ +A E+L Sbjct: 4 GGENYYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPD---NPKASELFHKLSKALEVL 59 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++N Y++L + +A+Q EI S + + ++E HPD D+ A F+++ +AY L Sbjct: 6 KKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKA---FIKVSEAYTTL 60 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 35.9 bits (79), Expect = 0.051 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 3/58 (5%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++N Y++L + +A+Q EI S + + ++E HPD D+ A F+++ +AY L Sbjct: 67 KKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKA---FIKVSEAYTTL 121 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 35.1 bits (77), Expect = 0.088 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 6/56 (10%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYE 339 E + Y VL + A+ EI +R LS+++HPDK E G +FM I +AYE Sbjct: 1246 EYDPYAVLEIDRGASVAEIRRQYRSLSKKYHPDK---ETG---DPRKFMRIAKAYE 1295 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 35.1 bits (77), Expect = 0.088 Identities = 15/57 (26%), Positives = 35/57 (61%), Gaps = 3/57 (5%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERFMEIQQAYEIL 341 ++ Y +L G AT ++I + +++ ++E HPDK +++ + E F +++A ++L Sbjct: 287 EDFYSLLDCGEYATNEQINTEFKKKAKEWHPDKKRNDTD---SHEYFARLKKARDVL 340 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 34.7 bits (76), Expect = 0.12 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 2/40 (5%) Query: 278 LSDPHGEQNAYKVLGLGPEATQQEITSTWRRLSREHHPDK 317 LS HG+ Y +LG+ PEA+ +I +R+L+ HPDK Sbjct: 794 LSRRHGDP--YSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 34.3 bits (75), Expect = 0.15 Identities = 16/42 (38%), Positives = 24/42 (57%) Query: 284 EQNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRR 325 E + Y VL + EA + E+ + +RRL +HPDK D +R Sbjct: 129 EVDYYAVLAVRKEANEDELKAAYRRLCVLYHPDKHTDPEKKR 170 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 33.9 bits (74), Expect = 0.20 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Query: 288 YKVLGLGPEATQQEITSTWRRLSREHHPDKVKDENGRRAAQERF 331 Y V+ L P AT +EI S + LSR +HPD N A+ERF Sbjct: 77 YDVMKLLPTATLREIKSAYYELSRIYHPDL----NSSAEARERF 116 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 31.9 bits (69), Expect = 0.82 Identities = 12/35 (34%), Positives = 23/35 (65%) Query: 285 QNAYKVLGLGPEATQQEITSTWRRLSREHHPDKVK 319 ++ Y++ G+ +AT +EI +++L+ HPDK K Sbjct: 27 EDYYELFGISRDATSKEIRKAFKKLALRLHPDKNK 61 >SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 31.1 bits (67), Expect = 1.4 Identities = 23/94 (24%), Positives = 40/94 (42%), Gaps = 4/94 (4%) Query: 251 DVKQCLIDTYQYAQHHG----WYEVWKQIIDLSDPHGEQNAYKVLGLGPEATQQEITSTW 306 DVK+ T +Y QH +Y WK + + H E +V G +++E + Sbjct: 286 DVKEVEQWTSEYKQHPNAIVKFYSTWKSMKPVISQHHEDEDSEVEFEGDSDSEEEKPKSK 345 Query: 307 RRLSREHHPDKVKDENGRRAAQERFMEIQQAYEI 340 +R S+ + K + A R EI+Q+ + Sbjct: 346 KRKSKTKERNTEKAQQKASKANARDKEIEQSENV 379 >SB_3343| Best HMM Match : DnaJ (HMM E-Value=0.067) Length = 29 Score = 29.5 bits (63), Expect = 4.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Query: 290 VLGLGPEATQQEITSTWRRLSREHHPDK 317 +LG+ PEA+ +I +R+L+ HPDK Sbjct: 2 ILGVPPEASDDDIKRQYRKLAVLIHPDK 29 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.326 0.141 0.470 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,872,415 Number of Sequences: 59808 Number of extensions: 484922 Number of successful extensions: 1161 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 1106 Number of HSP's gapped (non-prelim): 38 length of query: 358 length of database: 16,821,457 effective HSP length: 83 effective length of query: 275 effective length of database: 11,857,393 effective search space: 3260783075 effective search space used: 3260783075 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -