SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000606-TA|BGIBMGA000606-PA|undefined
         (81 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

10_08_0662 + 19662748-19662826,19662868-19663136,19664360-196645...    27   1.9  

>10_08_0662 +
           19662748-19662826,19662868-19663136,19664360-19664571,
           19665356-19665623,19665709-19666002
          Length = 373

 Score = 27.1 bits (57), Expect = 1.9
 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 3/30 (10%)

Query: 51  PEPTLLYNGEDCGPTPVRVRRSV---LGWI 77
           P P  L+ G++ G  PV+++R +   LGWI
Sbjct: 313 PFPVHLFQGDEDGVVPVQLQRHICRRLGWI 342


  Database: rice
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.323    0.144    0.513 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,766,323
Number of Sequences: 37544
Number of extensions: 33851
Number of successful extensions: 34
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 34
Number of HSP's gapped (non-prelim): 1
length of query: 81
length of database: 14,793,348
effective HSP length: 60
effective length of query: 21
effective length of database: 12,540,708
effective search space: 263354868
effective search space used: 263354868
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 52 (25.0 bits)

- SilkBase 1999-2023 -