BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000599-TA|BGIBMGA000599-PA|IPR011009|Protein kinase-like, IPR000719|Protein kinase (617 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 8.2 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 8.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.6 bits (46), Expect = 8.2 Identities = 8/21 (38%), Positives = 15/21 (71%) Query: 39 EIYDRNDDVYLQPDLNQFPDI 59 E +DR D++L+ L ++PD+ Sbjct: 577 EAFDRVKDLFLEAVLLRYPDL 597 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 470 LTHCLNQLDGGTAAKVELMSRDEQSVLVVSYAE 502 LT CL + G T+ +EL+ + + V +AE Sbjct: 95 LTFCLQEEGGTTSQLIELLGDAGKLLASVHFAE 127 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,802 Number of Sequences: 317 Number of extensions: 5618 Number of successful extensions: 13 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 11 Number of HSP's gapped (non-prelim): 2 length of query: 617 length of database: 114,650 effective HSP length: 61 effective length of query: 556 effective length of database: 95,313 effective search space: 52994028 effective search space used: 52994028 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -