BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000598-TA|BGIBMGA000598-PA|undefined (72 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q3IH23 Cluster: Putative orphan protein; n=1; Pseudoalt... 31 3.4 UniRef50_A5ZD11 Cluster: Putative uncharacterized protein; n=1; ... 31 4.6 >UniRef50_Q3IH23 Cluster: Putative orphan protein; n=1; Pseudoalteromonas haloplanktis TAC125|Rep: Putative orphan protein - Pseudoalteromonas haloplanktis (strain TAC 125) Length = 213 Score = 31.5 bits (68), Expect = 3.4 Identities = 18/44 (40%), Positives = 30/44 (68%), Gaps = 3/44 (6%) Query: 1 MAFSSLMQNEIASRSLMQNPQNGVWFSVTYGLRKINKMASSYLK 44 +AFS+L +NE + +L N ++ + F+V YGL+K+ K + S LK Sbjct: 18 LAFSTLEENEFTNVTL--NSEDKIEFTVKYGLQKV-KCSLSILK 58 >UniRef50_A5ZD11 Cluster: Putative uncharacterized protein; n=1; Bacteroides caccae ATCC 43185|Rep: Putative uncharacterized protein - Bacteroides caccae ATCC 43185 Length = 698 Score = 31.1 bits (67), Expect = 4.6 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 24 VWFSVTYGLRKINKMASSYLKHIL---QNGVWFSVDFGLRRIYKMTSGSLST 72 +WF+ YG++K SS LK L ++ +W+S L Y+ +G + T Sbjct: 262 LWFAAVYGMQKWKSKYSSLLKTQLPQMRDALWYSDGTKLNLYYRNEAGKMCT 313 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.321 0.130 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 68,584,421 Number of Sequences: 1657284 Number of extensions: 1939825 Number of successful extensions: 4531 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 4531 Number of HSP's gapped (non-prelim): 2 length of query: 72 length of database: 575,637,011 effective HSP length: 51 effective length of query: 21 effective length of database: 491,115,527 effective search space: 10313426067 effective search space used: 10313426067 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -