BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000598-TA|BGIBMGA000598-PA|undefined (72 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 0.97 DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 19 5.2 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 18 9.0 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 18 9.0 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 21.4 bits (43), Expect = 0.97 Identities = 14/45 (31%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Query: 10 EIASRSLMQNPQN-----GVWFSVTYGLRKINKMASSYLKHILQN 49 E S++LMQ ++FSV Y L ++ +M S+ ++L N Sbjct: 2 EYRSQTLMQTTLRLIRDLSLYFSVIYSLLRVKRMMRSWY-YLLTN 45 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 19.0 bits (37), Expect = 5.2 Identities = 7/20 (35%), Positives = 12/20 (60%) Query: 8 QNEIASRSLMQNPQNGVWFS 27 + E+A R+ + + VWFS Sbjct: 250 REELAQRTKLTEARIQVWFS 269 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 18.2 bits (35), Expect = 9.0 Identities = 7/16 (43%), Positives = 10/16 (62%) Query: 8 QNEIASRSLMQNPQNG 23 QNE S+ +N +NG Sbjct: 97 QNESLEASVNENSKNG 112 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 18.2 bits (35), Expect = 9.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Query: 1 MAFSSLMQNEIASRSLMQNPQNGVWF 26 M S L + EIA+ + Q +WF Sbjct: 140 MYLSRLRRIEIATCLRLSEKQVKIWF 165 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.130 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,457 Number of Sequences: 317 Number of extensions: 505 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 72 length of database: 114,650 effective HSP length: 45 effective length of query: 27 effective length of database: 100,385 effective search space: 2710395 effective search space used: 2710395 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 35 (19.2 bits) S2: 35 (18.2 bits)
- SilkBase 1999-2023 -