SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000597-TA|BGIBMGA000597-PA|IPR004142|Ndr
         (209 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface pro...    23   1.3  
AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory recept...    21   5.4  
AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory recept...    21   5.4  
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    21   9.4  

>AF322227-1|AAK01654.1|  782|Tribolium castaneum cell surface
           protein chaoptin protein.
          Length = 782

 Score = 23.4 bits (48), Expect = 1.3
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 73  RSLRSRGMTQGVLDYLLWHHFGRFPEDRNHDLTQMYKNY-FTRNVNPSNLSMFIE 126
           RSL+   +    ++ +   H G F  D + DLT++Y ++   RNV     +  I+
Sbjct: 66  RSLKKVHLQDNTIEMI---HRGTFQGDIHRDLTEVYFSFNSVRNVQQHTFADLIQ 117


>AM292360-1|CAL23172.2|  427|Tribolium castaneum gustatory receptor
           candidate 39 protein.
          Length = 427

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 7/11 (63%), Positives = 8/11 (72%)

Query: 86  DYLLWHHFGRF 96
           D LLWH FG +
Sbjct: 202 DMLLWHTFGYY 212


>AM292331-1|CAL23143.2|  437|Tribolium castaneum gustatory receptor
           candidate 10 protein.
          Length = 437

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 7/11 (63%), Positives = 8/11 (72%)

Query: 86  DYLLWHHFGRF 96
           D LLWH FG +
Sbjct: 202 DMLLWHTFGYY 212


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 20.6 bits (41), Expect = 9.4
 Identities = 12/41 (29%), Positives = 18/41 (43%)

Query: 118 PSNLSMFIEAYVRRSDLGICRNADTIKVPVLNITGALSPHV 158
           P N+S  +  +      GI  N  + +V  L+I    S HV
Sbjct: 633 PLNISWTLNGHFIDQTNGIVINRASKRVSTLSIDNVQSTHV 673


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.322    0.137    0.425 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 51,174
Number of Sequences: 317
Number of extensions: 2083
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of query: 209
length of database: 114,650
effective HSP length: 54
effective length of query: 155
effective length of database: 97,532
effective search space: 15117460
effective search space used: 15117460
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.9 bits)
S2: 41 (20.6 bits)

- SilkBase 1999-2023 -