BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000597-TA|BGIBMGA000597-PA|IPR004142|Ndr (209 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 23 1.3 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 5.4 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 5.4 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 21 9.4 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 23.4 bits (48), Expect = 1.3 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 4/55 (7%) Query: 73 RSLRSRGMTQGVLDYLLWHHFGRFPEDRNHDLTQMYKNY-FTRNVNPSNLSMFIE 126 RSL+ + ++ + H G F D + DLT++Y ++ RNV + I+ Sbjct: 66 RSLKKVHLQDNTIEMI---HRGTFQGDIHRDLTEVYFSFNSVRNVQQHTFADLIQ 117 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 86 DYLLWHHFGRF 96 D LLWH FG + Sbjct: 202 DMLLWHTFGYY 212 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Query: 86 DYLLWHHFGRF 96 D LLWH FG + Sbjct: 202 DMLLWHTFGYY 212 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 20.6 bits (41), Expect = 9.4 Identities = 12/41 (29%), Positives = 18/41 (43%) Query: 118 PSNLSMFIEAYVRRSDLGICRNADTIKVPVLNITGALSPHV 158 P N+S + + GI N + +V L+I S HV Sbjct: 633 PLNISWTLNGHFIDQTNGIVINRASKRVSTLSIDNVQSTHV 673 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.137 0.425 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,174 Number of Sequences: 317 Number of extensions: 2083 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 209 length of database: 114,650 effective HSP length: 54 effective length of query: 155 effective length of database: 97,532 effective search space: 15117460 effective search space used: 15117460 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -