BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000596-TA|BGIBMGA000596-PA|IPR004908|ATPase, V1 complex, subunit H (478 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 23 3.6 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 4.7 AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esteras... 23 6.2 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 23 6.2 AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. 23 6.2 AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. 23 6.2 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 23.4 bits (48), Expect = 3.6 Identities = 8/23 (34%), Positives = 12/23 (52%) Query: 435 DPNVRYEALLAVQKLMVHNWEYL 457 DP Y LL ++ H W+Y+ Sbjct: 69 DPKAMYTVLLEFVQIDPHRWKYV 91 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 4.7 Identities = 17/54 (31%), Positives = 26/54 (48%), Gaps = 3/54 (5%) Query: 135 LNLLNRQDEF-VQHMTARIIAKLACWHPQLMDKSDLHFYLSWLKDQLKTNNNDY 187 LN LN+ E +T + L W L +K+D +Y+S+ D K N+ Y Sbjct: 391 LNPLNKGTEADSSFVTLPQLHSLDEWDDTLKEKADFQYYVSY--DFYKMNHPVY 442 >AJ845189-1|CAH60166.1| 515|Tribolium castaneum putative esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 6.2 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 348 EVKSGRLEWSPVHKSAKFWRENAAR 372 E+K+G LE V + KFW N AR Sbjct: 438 ELKAGSLEEISVKRFVKFW-TNFAR 461 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 6.2 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 348 EVKSGRLEWSPVHKSAKFWRENAAR 372 E+K+G LE V + KFW N AR Sbjct: 440 ELKAGSLEEISVKRFVKFW-TNFAR 463 >AJ845187-1|CAH60164.1| 515|Tribolium castaneum esterase protein. Length = 515 Score = 22.6 bits (46), Expect = 6.2 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 348 EVKSGRLEWSPVHKSAKFWRENAAR 372 E+K+G LE V + KFW N AR Sbjct: 438 ELKTGSLEEISVKRFVKFW-TNFAR 461 >AJ844897-1|CAH59956.1| 517|Tribolium castaneum esterase protein. Length = 517 Score = 22.6 bits (46), Expect = 6.2 Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Query: 348 EVKSGRLEWSPVHKSAKFWRENAAR 372 E+K+G LE V + KFW N AR Sbjct: 440 ELKTGSLEEISVKRFVKFW-TNFAR 463 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.135 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,060 Number of Sequences: 317 Number of extensions: 4394 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 6 length of query: 478 length of database: 114,650 effective HSP length: 59 effective length of query: 419 effective length of database: 95,947 effective search space: 40201793 effective search space used: 40201793 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -