BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000594-TA|BGIBMGA000594-PA|IPR004142|Ndr (62 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC106.15 |idi1||isopentenyl-diphosphate delta-isomerase Idi1|S... 26 0.68 SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pom... 25 0.90 SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosacc... 24 2.1 SPCC1753.03c |rec7||meiotic recombination protein Rec7 |Schizosa... 23 4.8 SPBC8D2.14c |sed5||SNARE Sed5 |Schizosaccharomyces pombe|chr 2||... 23 4.8 SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces p... 22 8.3 SPAC23C4.14 |alg1||mannosyltransferase complex subunit Alg1 |Sch... 22 8.3 >SPBC106.15 |idi1||isopentenyl-diphosphate delta-isomerase Idi1|Schizosaccharomyces pombe|chr 2|||Manual Length = 227 Score = 25.8 bits (54), Expect = 0.68 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 3/54 (5%) Query: 10 QLQFPSARRFSGEAACTEVRVRTDRGDILV-AVQGDRNKPAIITYHDLGLNCKY 62 ++ FPS ++ + V +RG+ L AV+G +N +H+LG+ KY Sbjct: 75 KITFPSL--WTNTCCSHPLDVAGERGNTLPEAVEGVKNAAQRKLFHELGIQAKY 126 >SPAC57A7.12 |||heat shock protein Pdr13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 566 Score = 25.4 bits (53), Expect = 0.90 Identities = 9/24 (37%), Positives = 16/24 (66%) Query: 31 RTDRGDILVAVQGDRNKPAIITYH 54 R + D+L +G+R P+I++YH Sbjct: 42 RDGKTDVLANEEGNRQIPSILSYH 65 >SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosaccharomyces pombe|chr 1|||Manual Length = 922 Score = 24.2 bits (50), Expect = 2.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 1 MDDIELRNIQLQFPSARRF 19 M DIEL N+ +FPS F Sbjct: 732 MSDIELHNLCCKFPSINSF 750 >SPCC1753.03c |rec7||meiotic recombination protein Rec7 |Schizosaccharomyces pombe|chr 3|||Manual Length = 339 Score = 23.0 bits (47), Expect = 4.8 Identities = 8/20 (40%), Positives = 14/20 (70%) Query: 14 PSARRFSGEAACTEVRVRTD 33 P +RF G+A T++ +R+D Sbjct: 203 PPLKRFRGDAGMTQMPLRSD 222 >SPBC8D2.14c |sed5||SNARE Sed5 |Schizosaccharomyces pombe|chr 2|||Manual Length = 309 Score = 23.0 bits (47), Expect = 4.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 30 VRTDRGDILVAVQGDRNKPAIITYH 54 + +D + V+G+RNKPA + H Sbjct: 95 LNSDIASLQQVVKGNRNKPAQMNQH 119 >SPAC1952.02 |||ribosome biogenesis protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 202 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/32 (31%), Positives = 14/32 (43%) Query: 23 AACTEVRVRTDRGDILVAVQGDRNKPAIITYH 54 A ++V TD G + V G K + YH Sbjct: 56 AQLQSIQVNTDNGKVAVQSNGVSTKLRMAKYH 87 >SPAC23C4.14 |alg1||mannosyltransferase complex subunit Alg1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 424 Score = 22.2 bits (45), Expect = 8.3 Identities = 10/27 (37%), Positives = 16/27 (59%) Query: 28 VRVRTDRGDILVAVQGDRNKPAIITYH 54 ++ RTD+ I+V V GD + + YH Sbjct: 18 LKKRTDKKRIIVLVLGDIARSPRMQYH 44 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.324 0.140 0.416 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 252,570 Number of Sequences: 5004 Number of extensions: 6503 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 9 Number of HSP's gapped (non-prelim): 7 length of query: 62 length of database: 2,362,478 effective HSP length: 43 effective length of query: 19 effective length of database: 2,147,306 effective search space: 40798814 effective search space used: 40798814 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -