GeneModel BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000593-TA|BGIBMGA000593-PA|IPR000436|Sushi/SCR/CCP,
IPR007110|Immunoglobulin-like, IPR013106|Immunoglobulin V-set
         (333 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC3B9.14c |mrpl3||mitochondrial ribosomal protein subunit L3|S...    27   4.9  

>SPBC3B9.14c |mrpl3||mitochondrial ribosomal protein subunit
           L3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 326

 Score = 26.6 bits (56), Expect = 4.9
 Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 3/73 (4%)

Query: 244 ICSPIYCPDP---LVPEKGRLLIEPSSKHGKYTVGDLMIYDCEDGYDIVGESSIVCTENG 300
           +C  +   +P   ++ E GR   EP    G Y+   L+        ++  + +   +   
Sbjct: 224 LCKRLSLKEPVYRIIAETGRKSREPVFVIGAYSGHHLLGQGQASSLNLAEQQAAYNSLIS 283

Query: 301 YWSHPPPFCLLPS 313
           Y+ H PPF  LPS
Sbjct: 284 YYIHSPPFRQLPS 296


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.319    0.137    0.455 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,683,285
Number of Sequences: 5004
Number of extensions: 71922
Number of successful extensions: 122
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 122
Number of HSP's gapped (non-prelim): 1
length of query: 333
length of database: 2,362,478
effective HSP length: 73
effective length of query: 260
effective length of database: 1,997,186
effective search space: 519268360
effective search space used: 519268360
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 54 (25.8 bits)