BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000592-TA|BGIBMGA000592-PA|IPR008283|Peptidase M17, leucyl aminopeptidase, N-terminal, IPR000819|Peptidase M17, leucyl aminopeptidase, C-terminal, IPR011356|Peptidase M17, leucyl aminopeptidase (452 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 24 2.5 AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory recept... 23 4.4 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 23.8 bits (49), Expect = 2.5 Identities = 10/26 (38%), Positives = 17/26 (65%) Query: 306 LVYARNYWPKLIIDIGTMSKELIYTL 331 L++ N++P+LII I + LI+ L Sbjct: 86 LIFLVNWYPRLIIGIMNSTLNLIFLL 111 >AM292371-1|CAL23183.2| 350|Tribolium castaneum gustatory receptor candidate 50 protein. Length = 350 Score = 23.0 bits (47), Expect = 4.4 Identities = 10/33 (30%), Positives = 21/33 (63%) Query: 24 AFVAVSGLGSECLTYNVSEQLDENKEAIRIAAG 56 +F V LGS ++ ++ ++D + E+I +A+G Sbjct: 39 SFSVVLSLGSFIVSVYLTTKIDNDGESISLASG 71 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,075 Number of Sequences: 317 Number of extensions: 4327 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 3 Number of HSP's gapped (non-prelim): 2 length of query: 452 length of database: 114,650 effective HSP length: 59 effective length of query: 393 effective length of database: 95,947 effective search space: 37707171 effective search space used: 37707171 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -