BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000592-TA|BGIBMGA000592-PA|IPR008283|Peptidase M17, leucyl aminopeptidase, N-terminal, IPR000819|Peptidase M17, leucyl aminopeptidase, C-terminal, IPR011356|Peptidase M17, leucyl aminopeptidase (452 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 25 1.3 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 9.2 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 25.0 bits (52), Expect = 1.3 Identities = 14/34 (41%), Positives = 17/34 (50%) Query: 272 GNSPKFGDVAYSANGKSLHIRLPSREGRLLIADS 305 G++P D K LH RLP R LL AD+ Sbjct: 92 GSTPDSRDYFSRPFEKRLHSRLPGRNFNLLRADA 125 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.2 bits (45), Expect = 9.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Query: 142 NMLNPTSFAKIAVELLCELDINV 164 N +PT+ K+ L CE D NV Sbjct: 37 NYDHPTTLLKLKRYLFCEYDPNV 59 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,854 Number of Sequences: 429 Number of extensions: 5096 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 452 length of database: 140,377 effective HSP length: 60 effective length of query: 392 effective length of database: 114,637 effective search space: 44937704 effective search space used: 44937704 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -