BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000590-TA|BGIBMGA000590-PA|IPR000762|PTN/MK heparin-binding protein (114 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 26 0.081 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 26 0.081 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 26.2 bits (55), Expect = 0.081 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 57 RSRKLTLKKGDPANCEVVKTIQKKCKRTCRYEK 89 R+R+ K D +C + KT + +C R CR +K Sbjct: 68 RNRQYVCKAKDEGSCIIDKTHRNQC-RACRLKK 99 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 26.2 bits (55), Expect = 0.081 Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 57 RSRKLTLKKGDPANCEVVKTIQKKCKRTCRYEK 89 R+R+ K D +C + KT + +C R CR +K Sbjct: 68 RNRQYVCKAKDEGSCIIDKTHRNQC-RACRLKK 99 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.312 0.125 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,519 Number of Sequences: 317 Number of extensions: 815 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 114 length of database: 114,650 effective HSP length: 49 effective length of query: 65 effective length of database: 99,117 effective search space: 6442605 effective search space used: 6442605 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.1 bits) S2: 38 (19.4 bits)
- SilkBase 1999-2023 -