BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000588-TA|BGIBMGA000588-PA|undefined (382 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 23 2.8 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 6.4 DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 prot... 22 6.4 AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 pro... 22 6.4 AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 prot... 22 6.4 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 6.4 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 8.4 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 23.4 bits (48), Expect = 2.8 Identities = 10/27 (37%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Query: 111 WYT-WSTEKRTDGSKATNYYICYDEPK 136 W T W E++T N ++ YD PK Sbjct: 315 WTTVWDDEQKTPYMYKGNQWVGYDNPK 341 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.2 bits (45), Expect = 6.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Query: 264 LKREVPSEDENKVSTTTETRQRSVHRSKKIVREE 297 LKR +P + + TE ++ + +RS K +++E Sbjct: 60 LKRVLPEALQTNCAKCTEKQRTAAYRSIKRLKKE 93 >DQ659249-1|ABG47447.1| 383|Tribolium castaneum chitinase 9 protein. Length = 383 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/36 (25%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 102 NSMFKFGENW-YTWSTEKRTDGSKATNYYICYDEPK 136 N + + +W Y W E++ N ++ +D+PK Sbjct: 301 NEVCELYSDWDYFWDDEQQVPHIVKGNQWLGFDDPK 336 >AY873915-1|AAW67571.2| 384|Tribolium castaneum chitinase 16 protein. Length = 384 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/36 (25%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 102 NSMFKFGENW-YTWSTEKRTDGSKATNYYICYDEPK 136 N + + +W Y W E++ N ++ +D+PK Sbjct: 302 NEVCELYSDWDYFWDDEQQVPHIVKGNQWLGFDDPK 337 >AY873914-1|AAW67570.1| 384|Tribolium castaneum chitinase 3 protein. Length = 384 Score = 22.2 bits (45), Expect = 6.4 Identities = 9/36 (25%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 102 NSMFKFGENW-YTWSTEKRTDGSKATNYYICYDEPK 136 N + + +W Y W E++ N ++ +D+PK Sbjct: 302 NEVCELYSDWDYFWDDEQQVPHIVKGNQWLGFDDPK 337 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 22.2 bits (45), Expect = 6.4 Identities = 10/21 (47%), Positives = 13/21 (61%) Query: 267 EVPSEDENKVSTTTETRQRSV 287 E PS N+ TTTE+ + SV Sbjct: 311 EKPSSSSNQEKTTTESAKISV 331 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.8 bits (44), Expect = 8.4 Identities = 9/17 (52%), Positives = 11/17 (64%) Query: 28 DQEDSRVDDEDTSRTES 44 D E+ VDD+DT ES Sbjct: 38 DDENITVDDDDTDGRES 54 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.316 0.132 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,042 Number of Sequences: 317 Number of extensions: 3162 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 7 length of query: 382 length of database: 114,650 effective HSP length: 58 effective length of query: 324 effective length of database: 96,264 effective search space: 31189536 effective search space used: 31189536 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -