BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000588-TA|BGIBMGA000588-PA|undefined (382 letters) Database: human 224,733 sequences; 73,234,838 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC108733-1|AAI08734.1| 685|Homo sapiens Unknown (protein for IM... 31 9.0 AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related ... 31 9.0 >BC108733-1|AAI08734.1| 685|Homo sapiens Unknown (protein for IMAGE:3877752) protein. Length = 685 Score = 30.7 bits (66), Expect = 9.0 Identities = 19/100 (19%), Positives = 41/100 (41%) Query: 245 DRITFSLHEPTRGQTFKSALKREVPSEDENKVSTTTETRQRSVHRSKKIVREEXXXXXXX 304 +++ +P + +T S ++EVPS++E +++ K +E+ Sbjct: 584 EKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETK 643 Query: 305 XXXXXXXEGKDNYKVKERNESGYTSRREDTKTKKFRVRPK 344 E K+ K + + T +++ K KK V+ K Sbjct: 644 VKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKK 683 >AF414442-1|AAL65133.2|22152|Homo sapiens ovarian cancer related tumor marker CA125 protein. Length = 22152 Score = 30.7 bits (66), Expect = 9.0 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 20 VNDKPVVIDQEDSRVDDEDTSRTESW-DRKKGIDIT 54 +N+K + +Q+ SR DE S T SW D+ G DIT Sbjct: 3405 LNNKIMAAEQQTSRSVDEAYSSTSSWSDQTSGSDIT 3440 Database: human Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 73,234,838 Number of sequences in database: 224,733 Lambda K H 0.316 0.132 0.399 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 49,676,754 Number of Sequences: 224733 Number of extensions: 1877163 Number of successful extensions: 3615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 3614 Number of HSP's gapped (non-prelim): 2 length of query: 382 length of database: 73,234,838 effective HSP length: 91 effective length of query: 291 effective length of database: 52,784,135 effective search space: 15360183285 effective search space used: 15360183285 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 66 (30.7 bits)
- SilkBase 1999-2023 -