BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000586-TA|BGIBMGA000586-PA|IPR002502|N-acetylmuramoyl-L- alanine amidase, family 2, IPR006619|Animal peptidoglycan recognition protein PGRP (253 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G6.16c |ysh1||mRNA cleavage and polyadenylation specificit... 30 0.37 SPCC18.05c |||notchless-like protein|Schizosaccharomyces pombe|c... 28 1.5 SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe... 26 4.6 SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyc... 26 6.1 SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces... 25 8.0 SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF... 25 8.0 >SPAC17G6.16c |ysh1||mRNA cleavage and polyadenylation specificity factor complex subunit Ysh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 775 Score = 29.9 bits (64), Expect = 0.37 Identities = 14/46 (30%), Positives = 22/46 (47%) Query: 147 LVGAHTYHYNRCSLGIGFLGDYREELDPHTRVTDLQIARTKILLED 192 ++GA Y + I F GDY E D H V ++ R +L+ + Sbjct: 184 VLGACMYFVEMAGVNILFTGDYSREEDRHLHVAEVPPKRPDVLITE 229 >SPCC18.05c |||notchless-like protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 502 Score = 27.9 bits (59), Expect = 1.5 Identities = 10/31 (32%), Positives = 18/31 (58%) Query: 111 QMRILQSNVLNNLEDDIPYNFLIGNDGRVYE 141 Q+ L + +L N +D +PYNF + ++ E Sbjct: 57 QLEALLNQLLENSDDPVPYNFALHHEDETIE 87 >SPBC359.05 |abc3||ABC transporter Abc3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1465 Score = 26.2 bits (55), Expect = 4.6 Identities = 11/20 (55%), Positives = 15/20 (75%) Query: 164 FLGDYREELDPHTRVTDLQI 183 F G+ RE LDP+ R+TD +I Sbjct: 1313 FEGNIRENLDPNHRLTDKKI 1332 >SPCC970.09 |sec8||exocyst complex subunit Sec8|Schizosaccharomyces pombe|chr 3|||Manual Length = 1088 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/38 (31%), Positives = 21/38 (55%) Query: 105 FQTCASQMRILQSNVLNNLEDDIPYNFLIGNDGRVYEG 142 F + +M +LQ N N D +P + L+GN+ + +G Sbjct: 822 FMNGSRRMNVLQQNQANFGGDFLPIDNLLGNNSDLMKG 859 >SPAC3H8.04 |||chromosome segregation protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.4 bits (53), Expect = 8.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Query: 149 GAHTYHYNRCSLGIGFLGDYREEL 172 G +TY C GF+G Y E L Sbjct: 124 GINTYSLKNCFQRSGFIGSYEESL 147 >SPCC970.01 |rad16|rad10, rad20, swi9|DNA repair endonuclease XPF|Schizosaccharomyces pombe|chr 3|||Manual Length = 892 Score = 25.4 bits (53), Expect = 8.0 Identities = 25/84 (29%), Positives = 37/84 (44%), Gaps = 6/84 (7%) Query: 6 KLPLPRYLWKVLKNTSRAERLSCSVA--LTALVICIGLTLYFALTTETV----ANDDDID 59 K+ LP + + N E C +A L+ L I + YFA+ + AN DDI+ Sbjct: 4 KVHLPLAYQQQVFNELIEEDGLCVIAPGLSLLQIAANVLSYFAVPGSLLLLVGANVDDIE 63 Query: 60 VAPHEWNITREMWLAQIVNDTESV 83 + HE E L + +T SV Sbjct: 64 LIQHEMESHLEKKLITVNTETMSV 87 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.322 0.138 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,232,288 Number of Sequences: 5004 Number of extensions: 51410 Number of successful extensions: 105 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 100 Number of HSP's gapped (non-prelim): 6 length of query: 253 length of database: 2,362,478 effective HSP length: 71 effective length of query: 182 effective length of database: 2,007,194 effective search space: 365309308 effective search space used: 365309308 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -