BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000586-TA|BGIBMGA000586-PA|IPR002502|N-acetylmuramoyl-L- alanine amidase, family 2, IPR006619|Animal peptidoglycan recognition protein PGRP (253 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxyge... 22 5.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.2 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 6.9 AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxyge... 21 9.1 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 9.1 >AY052395-1|AAL15469.1| 76|Tribolium castaneum tryptophan oxygenase protein. Length = 76 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/31 (25%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Query: 54 NDDDIDVAPHEWNITREMWLAQIVNDTESVR 84 +D+ + + H+ E+W QI+ + +S+R Sbjct: 49 HDEHLFIVTHQ---AYELWFKQIIYELDSIR 76 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/31 (25%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Query: 54 NDDDIDVAPHEWNITREMWLAQIVNDTESVR 84 +D+ + + H+ E+W QI+ + +S+R Sbjct: 49 HDEHLFIVTHQ---AYELWFKQIIYELDSIR 76 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/31 (25%), Positives = 18/31 (58%), Gaps = 3/31 (9%) Query: 54 NDDDIDVAPHEWNITREMWLAQIVNDTESVR 84 +D+ + + H+ E+W QI+ + +S+R Sbjct: 49 HDEHLFIVTHQ---AYELWFKQIIYELDSIR 76 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Query: 223 KALKSFEHFDHKGILAN 239 KA +SFE H+ ++AN Sbjct: 86 KAPQSFEDIQHQRVMAN 102 >AY052625-1|AAL15473.1| 135|Tribolium castaneum tryptophan oxygenase protein. Length = 135 Score = 21.0 bits (42), Expect = 9.1 Identities = 6/15 (40%), Positives = 11/15 (73%) Query: 70 EMWLAQIVNDTESVR 84 E+W QI+ + +S+R Sbjct: 2 ELWFKQIIYELDSIR 16 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 9.1 Identities = 6/10 (60%), Positives = 8/10 (80%) Query: 202 KYYINGACDF 211 K+Y NG CD+ Sbjct: 576 KHYANGLCDY 585 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.138 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,953 Number of Sequences: 317 Number of extensions: 2672 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 1 Number of HSP's gapped (non-prelim): 6 length of query: 253 length of database: 114,650 effective HSP length: 55 effective length of query: 198 effective length of database: 97,215 effective search space: 19248570 effective search space used: 19248570 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -