BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000586-TA|BGIBMGA000586-PA|IPR002502|N-acetylmuramoyl-L- alanine amidase, family 2, IPR006619|Animal peptidoglycan recognition protein PGRP (253 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_44273| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_53412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1459 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Query: 121 NNLEDDIPYNFLIGNDGRVYEGRGWGLVGAHTYHYNRCSLGIGFLGDYREEL 172 N+L+D +PYNF G GR + G G + Y +G ++ D +E+L Sbjct: 854 NSLQDFMPYNFTEG-PGRYHNEVGSMDNGPNPVTYGNHVIGRPYIEDQQEDL 904 >SB_44273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%) Query: 56 DDIDVAPHEWNITREMWLA---QIVNDTESVREYNPIRLVIVQHTVSP 100 D++D + HE N+ +W++ QI ES + RL + T+SP Sbjct: 21 DELDTSFHEMNLDGFLWMSPQQQITTGYESTTDTPSRRLSLQDSTLSP 68 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.322 0.138 0.429 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,944,514 Number of Sequences: 59808 Number of extensions: 361435 Number of successful extensions: 758 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 758 Number of HSP's gapped (non-prelim): 2 length of query: 253 length of database: 16,821,457 effective HSP length: 80 effective length of query: 173 effective length of database: 12,036,817 effective search space: 2082369341 effective search space used: 2082369341 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 59 (27.9 bits)
- SilkBase 1999-2023 -