BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000585-TA|BGIBMGA000585-PA|IPR002502|N-acetylmuramoyl-L- alanine amidase, family 2, IPR006619|Animal peptidoglycan recognition protein PGRP (304 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 5.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 7.7 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 5.9 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Query: 63 VTQKVRNTEEIKGQLLGLELVSSQN-TRKIRCSIAV 97 VT++ + LLGL+L++++N T I+ S+ V Sbjct: 262 VTEQALDASNAPEGLLGLKLINAENETAHIKDSLIV 297 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.8 bits (44), Expect = 7.7 Identities = 10/52 (19%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Query: 156 SFVIIGHTVTQYCNQKYDCIKKIINVQKSHLDARFEDIGPNFLISGNGIVFE 207 S ++I H + N Y C+ + + + SH + P +++ + E Sbjct: 668 SILMIEHLSPDH-NGNYSCVARNLAAEVSHTQRLVVHVPPRWIVEPTDVSVE 718 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.323 0.137 0.422 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 85,239 Number of Sequences: 429 Number of extensions: 3346 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 5 Number of HSP's gapped (non-prelim): 2 length of query: 304 length of database: 140,377 effective HSP length: 57 effective length of query: 247 effective length of database: 115,924 effective search space: 28633228 effective search space used: 28633228 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 44 (21.8 bits)
- SilkBase 1999-2023 -