BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000581-TA|BGIBMGA000581-PA|IPR001623|Heat shock protein DnaJ, N-terminal (535 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 24 2.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 4.8 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 417 PEQTGDGVSPESPSPYSDVIDVTIPVQ 443 P T +P SP P D +D+ IPV+ Sbjct: 433 PILTPPSSNPVSPVPSPDPLDLAIPVR 459 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 4.8 Identities = 12/35 (34%), Positives = 16/35 (45%) Query: 403 LYGKLPADTSSHVIPEQTGDGVSPESPSPYSDVID 437 L GKLP D + P+ S + SP S +D Sbjct: 431 LDGKLPHDDQPPLSPQSDSSSSSRSAESPMSVQVD 465 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,701 Number of Sequences: 429 Number of extensions: 5580 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 535 length of database: 140,377 effective HSP length: 61 effective length of query: 474 effective length of database: 114,208 effective search space: 54134592 effective search space used: 54134592 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -