BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000581-TA|BGIBMGA000581-PA|IPR001623|Heat shock protein DnaJ, N-terminal (535 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 141 1e-33 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 80 4e-15 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 75 2e-13 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 74 3e-13 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 2e-12 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 4e-12 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 70 4e-12 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 70 4e-12 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 64 3e-10 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 64 4e-10 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 63 6e-10 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 6e-10 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 8e-10 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 1e-09 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 3e-08 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 57 3e-08 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 5e-08 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 5e-08 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 56 9e-08 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 56 9e-08 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 9e-08 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 54 4e-07 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 4e-07 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-06 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 48 2e-05 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 48 2e-05 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 2e-04 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 45 2e-04 SB_44151| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.002 SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) 40 0.004 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.062 SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.14 SB_57035| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.33 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.33 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 32 1.3 SB_14525| Best HMM Match : Phospholip_A2_1 (HMM E-Value=2.2) 31 1.8 SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) 31 2.3 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 30 5.3 SB_55890| Best HMM Match : Filamin (HMM E-Value=0.02) 30 5.3 SB_47749| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.068) 29 7.1 SB_45349| Best HMM Match : rve (HMM E-Value=6.1e-31) 29 9.3 SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) 29 9.3 SB_46805| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.3 SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) 29 9.3 SB_9147| Best HMM Match : Sushi (HMM E-Value=0) 29 9.3 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 141 bits (342), Expect = 1e-33 Identities = 69/192 (35%), Positives = 123/192 (64%), Gaps = 4/192 (2%) Query: 196 QLDAHSVGYLTYRAGNQGSSMTSIYVRDSEKYHSNTAIQIGNPHSFISFNVMRKLPQHDL 255 QLD H+VGYLT++AG Q SSM + +R++E Y + +++G P++F +V +KL + Sbjct: 392 QLDKHTVGYLTWKAGAQ-SSMNTTVIRETEDYRAVLTLKLGVPNTFGVASVTKKL--EET 448 Query: 256 KLRLAVKFGTFGAIAEYGAEKKVSQNSSVSAAVMLGVPSGVMLKLKWTCSSQTIVVPIHL 315 +L+LA+K G FG I EYG EKK+SQ+S + A++ +GVP+GV LK+K T ++Q P+ L Sbjct: 449 RLKLAIKGGIFGMIFEYGIEKKISQHSQLGASISIGVPTGVTLKIKLTRATQVYSFPVSL 508 Query: 316 CEEVMPSPVFYATVVPLVSWMILKKIVLDPIAXXXXXXXXXXSMEANFERLQEMQRQARA 375 E++ P+ +FY T+ P+V +++ K +V+ P + E + ++L + +++A Sbjct: 509 SEQISPAAIFYGTIAPVVVFLVAKVLVVSPFKKQEQEKEEELNREKHAQQLAKKKQEAED 568 Query: 376 TVELMRETYSRI 387 T + T++++ Sbjct: 569 T-RTVHSTHAQV 579 Score = 96.3 bits (229), Expect = 5e-20 Identities = 75/225 (33%), Positives = 113/225 (50%), Gaps = 51/225 (22%) Query: 11 EDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQK------W---------- 54 E +YY +L V K A+ +E+ +AYRR ++HPDKH TDP K++ W Sbjct: 129 EVDYYAVLAVRKEANEDELKAAYRRLCVLYHPDKH-TDPEKKRVCAKLVWCLPELEEFIL 187 Query: 55 ----------AEQIFNKVKEAYEVLSDSHKRAIYDTLGKRGLEV-------DGW---EVI 94 A Q+F+KV++AYEVLSD +AIY + ++ + D W + Sbjct: 188 FDICECILQVAVQLFSKVQKAYEVLSDPETKAIYVFMARKAWMLVGSYCIDDAWLGGGCL 247 Query: 95 FRTRTPXXXXXXXXXXXXXXXXXXLQ---------QSANPRGTITLSINATDMFTKYYDE 145 + ++ LQ Q NP+G++ + ++ATD+F D Sbjct: 248 TKIQSSLVTVLMMRGLEIQAEYERLQREKEERRLQQRTNPKGSVIVGVDATDLF----DH 303 Query: 146 YEIMEETTVIPNIEVSGMTIQQSIDAPVTLRNTMTLSGNISTQNG 190 YE +EE +PNIEVS M I QSI+AP+T +T TLSG++ +NG Sbjct: 304 YEGLEERG-LPNIEVSNMAIMQSIEAPLTRMDTATLSGSLGVRNG 347 Score = 76.2 bits (179), Expect = 6e-14 Identities = 34/71 (47%), Positives = 48/71 (67%) Query: 430 SPYSDVIDVTIPVQCLVKDSRLELLEASKSELPGFYDPCVGEDKHLTVQYMFHNNLHCCT 489 S ++ VIDVT+PVQC V++SRL L E K L GFYDPC +DK L ++Y F + LH T Sbjct: 574 STHAQVIDVTVPVQCQVRESRLFLAEGPKHNLSGFYDPCPNQDKLLRIRYEFRDALHEVT 633 Query: 490 VPDNQAIVLPR 500 + + + I +P+ Sbjct: 634 IGELETIRIPK 644 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 80.2 bits (189), Expect = 4e-15 Identities = 38/81 (46%), Positives = 54/81 (66%), Gaps = 3/81 (3%) Query: 10 LEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVL 69 + ++YY++L V ++AS E++ AYRR + +HPDK+ P ++ AE+ F K+ EAYEVL Sbjct: 1 MSEDYYEVLGVPRSASEEDVKKAYRRQALRWHPDKN---PTNREHAEEKFKKLSEAYEVL 57 Query: 70 SDSHKRAIYDTLGKRGLEVDG 90 SD KR IYD GK GL G Sbjct: 58 SDKEKRDIYDKYGKEGLTSQG 78 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 74.5 bits (175), Expect = 2e-13 Identities = 37/84 (44%), Positives = 56/84 (66%), Gaps = 5/84 (5%) Query: 8 ILLEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYE 67 +++ +YYQ+L V + AS ++I A+R+ + +HPDK NK K AE+ F +V EAYE Sbjct: 21 LVMAKDYYQILGVPRNASDKQIKKAFRKMAVKYHPDK-----NKGKDAEEKFREVAEAYE 75 Query: 68 VLSDSHKRAIYDTLGKRGLEVDGW 91 VLSD +KR YD G+ GL+ +G+ Sbjct: 76 VLSDENKRRQYDQFGEEGLKNNGF 99 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 74.1 bits (174), Expect = 3e-13 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 5/75 (6%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 +YY +LNV K AS ++I AYR+ + +HPDK NK AE+ F ++ EAYEVLSD Sbjct: 4 DYYAVLNVDKAASADDIKKAYRKQALKYHPDK-----NKSPGAEEKFKEISEAYEVLSDP 58 Query: 73 HKRAIYDTLGKRGLE 87 K+ IYD G+ GL+ Sbjct: 59 KKKEIYDQYGEEGLK 73 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 71.3 bits (167), Expect = 2e-12 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 5/75 (6%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 NYY +L V K AS +E+ AY++ + +HPDK NK AE+ F ++ EAYEVLSD Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDK-----NKDPGAEEKFKEIAEAYEVLSDP 58 Query: 73 HKRAIYDTLGKRGLE 87 KR I+D G+ GL+ Sbjct: 59 QKREIFDQYGEEGLK 73 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 70.1 bits (164), Expect = 4e-12 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQ-KWAEQIFNKVKEAYEVLSD 71 +YY++LN+SKTAS +EI AY++ + HPD+HS ++Q K AE+ F +V EAY +LSD Sbjct: 159 DYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSD 218 Query: 72 SHKRAIYDT 80 K+ YD+ Sbjct: 219 PKKKRRYDS 227 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 70.1 bits (164), Expect = 4e-12 Identities = 33/69 (47%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQ-KWAEQIFNKVKEAYEVLSD 71 +YY++LN+SKTAS +EI AY++ + HPD+HS ++Q K AE+ F +V EAY +LSD Sbjct: 159 DYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEVNEAYSILSD 218 Query: 72 SHKRAIYDT 80 K+ YD+ Sbjct: 219 PKKKRRYDS 227 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 70.1 bits (164), Expect = 4e-12 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 5/75 (6%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 NYY +L V + AS ++I AYRR + +FHPDK NK AE+ F ++ EAY+VL+D Sbjct: 4 NYYAILGVPRNASDDDIKKAYRRQALIFHPDK-----NKNSGAEEKFKEISEAYKVLTDP 58 Query: 73 HKRAIYDTLGKRGLE 87 +R I+D G+ GL+ Sbjct: 59 RQRDIFDMYGEEGLK 73 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 64.1 bits (149), Expect = 3e-10 Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 4/78 (5%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 ++Y +L V + AS +I AYR+ + HPDK+ DP A++ F+ + AYEVL+D Sbjct: 25 DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPK----AQEKFHDIGAAYEVLADD 80 Query: 73 HKRAIYDTLGKRGLEVDG 90 +R IYD G+ GL+ G Sbjct: 81 DQRKIYDQRGEEGLKNAG 98 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 63.7 bits (148), Expect = 4e-10 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 5/75 (6%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 +YY +L ++++A+ +I YR+ S +HPDK N++ AE F + EAY+VLSD Sbjct: 4 DYYDILGLTRSATDADIKKEYRKLSLKYHPDK-----NQEPSAEVKFRQAAEAYDVLSDP 58 Query: 73 HKRAIYDTLGKRGLE 87 KRAIY+ G+ GL+ Sbjct: 59 KKRAIYNQFGEEGLK 73 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 62.9 bits (146), Expect = 6e-10 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 5/77 (6%) Query: 10 LEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVL 69 ++DN+YQ+L V TA+ EI AYRR S HPD+ NK+ AE F K+ EVL Sbjct: 2480 VKDNFYQVLGVETTATQAEIRRAYRRISLQLHPDR-----NKEDDAELKFRKLVAVAEVL 2534 Query: 70 SDSHKRAIYDTLGKRGL 86 D KR YDT+ + G+ Sbjct: 2535 KDEDKRKRYDTILRDGM 2551 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 62.9 bits (146), Expect = 6e-10 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 N Y +L VSKTAS EI AYR+ S HPD+ D +++ A + F + ++Y +LSD Sbjct: 15 NLYDVLGVSKTASESEIKRAYRKISLQVHPDR--ADKGEKEKATRKFQALSKSYCILSDK 72 Query: 73 HKRAIYDTLGK 83 KRAIYD G+ Sbjct: 73 EKRAIYDESGE 83 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 62.5 bits (145), Expect = 8e-10 Identities = 32/75 (42%), Positives = 44/75 (58%), Gaps = 5/75 (6%) Query: 9 LLEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEV 68 L +YY++L V A+ +EI AY ++ +HPD NK K A + F +V EAYEV Sbjct: 55 LQRKDYYKILGVPPNANQKEIKKAYFELAKKYHPDT-----NKDKSASEKFQEVSEAYEV 109 Query: 69 LSDSHKRAIYDTLGK 83 LSD KR YD+ G+ Sbjct: 110 LSDDGKRKAYDSFGQ 124 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 62.1 bits (144), Expect = 1e-09 Identities = 31/80 (38%), Positives = 47/80 (58%), Gaps = 7/80 (8%) Query: 11 EDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLS 70 E YY +LNV TA+ EI +YR+ + +HPDK+ + ++ F ++ +AYEVLS Sbjct: 63 ETAYYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGDR-------FKQISQAYEVLS 115 Query: 71 DSHKRAIYDTLGKRGLEVDG 90 D KR IYD G+ ++ G Sbjct: 116 DEKKRKIYDEGGEDAIKGGG 135 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 58.4 bits (135), Expect = 1e-08 Identities = 28/70 (40%), Positives = 43/70 (61%), Gaps = 7/70 (10%) Query: 10 LEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVL 69 +E NYY++L V + A+ ++I AYRR + +HPDK++ E+ F +V EAYEVL Sbjct: 1 MESNYYEVLGVERNATTDDIRRAYRRLALKYHPDKNA-------GTEENFKEVSEAYEVL 53 Query: 70 SDSHKRAIYD 79 D +R +D Sbjct: 54 CDPQQRERFD 63 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 57.2 bits (132), Expect = 3e-08 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 4/67 (5%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 N+Y++L+V K AS EI SA+ + ++ FHPD + DP+ K F KV EAY LS S Sbjct: 8 NFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHK----AFIKVSEAYTTLSSS 63 Query: 73 HKRAIYD 79 +R YD Sbjct: 64 ARRQQYD 70 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 57.2 bits (132), Expect = 3e-08 Identities = 30/67 (44%), Positives = 41/67 (61%), Gaps = 4/67 (5%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 N+Y++L+V K AS EI SA+ + ++ FHPD + DP+ K F KV EAY LS S Sbjct: 69 NFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHK----AFIKVSEAYTTLSSS 124 Query: 73 HKRAIYD 79 +R YD Sbjct: 125 ARRQQYD 131 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 56.4 bits (130), Expect = 5e-08 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 7/78 (8%) Query: 9 LLEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEV 68 + + Y LL V + AS +I AYR+ ++ HPDK+ K F + AYE+ Sbjct: 1 MADTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEK-------FKDITFAYEI 53 Query: 69 LSDSHKRAIYDTLGKRGL 86 LSD KR +YD G++GL Sbjct: 54 LSDPEKRELYDRYGEKGL 71 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 56.4 bits (130), Expect = 5e-08 Identities = 29/78 (37%), Positives = 42/78 (53%), Gaps = 7/78 (8%) Query: 9 LLEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEV 68 + + Y LL V + AS +I AYR+ ++ HPDK+ K F + AYE+ Sbjct: 1 MADTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGEK-------FKDITFAYEI 53 Query: 69 LSDSHKRAIYDTLGKRGL 86 LSD KR +YD G++GL Sbjct: 54 LSDPEKRELYDRYGEKGL 71 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 55.6 bits (128), Expect = 9e-08 Identities = 31/78 (39%), Positives = 41/78 (52%), Gaps = 8/78 (10%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 NYY +L VS AS +I AY + S HPD+H K ++F ++ EAY VL + Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKK----HEVFQEIAEAYSVLGNL 127 Query: 73 HKRAIYDTLGKRGLEVDG 90 R YD RGL V+G Sbjct: 128 ESRKQYD----RGLIVEG 141 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 55.6 bits (128), Expect = 9e-08 Identities = 25/59 (42%), Positives = 41/59 (69%), Gaps = 3/59 (5%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSD 71 +YY +L V ++AS ++I +YR+ + +HPDK +P ++ AE+ F ++ EAYEVLSD Sbjct: 3 DYYDILEVPRSASEQDIKKSYRKLALKWHPDK---NPQNKEEAERKFKEISEAYEVLSD 58 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 55.6 bits (128), Expect = 9e-08 Identities = 31/78 (39%), Positives = 41/78 (52%), Gaps = 8/78 (10%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 NYY +L VS AS +I AY + S HPD+H K ++F ++ EAY VL + Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKK----HEVFQEIAEAYSVLGNL 127 Query: 73 HKRAIYDTLGKRGLEVDG 90 R YD RGL V+G Sbjct: 128 ESRKQYD----RGLIVEG 141 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 53.6 bits (123), Expect = 4e-07 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 4/70 (5%) Query: 12 DNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSD 71 +NYY L V K ++ +EI AYR+ + HPDK+ +P A ++F+K+ +A EVL+D Sbjct: 6 ENYYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPK----ASELFHKLSKALEVLTD 61 Query: 72 SHKRAIYDTL 81 RA ++ L Sbjct: 62 PKARAAFNNL 71 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 53.6 bits (123), Expect = 4e-07 Identities = 25/67 (37%), Positives = 41/67 (61%), Gaps = 2/67 (2%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 +YY++L + + + EI AYR+ + +HPD + + K+ AE++F + A EVL+D Sbjct: 208 DYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKK--AEKMFIDIAAAKEVLTDP 265 Query: 73 HKRAIYD 79 KRA YD Sbjct: 266 EKRAKYD 272 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 50.8 bits (116), Expect = 3e-06 Identities = 27/71 (38%), Positives = 47/71 (66%), Gaps = 4/71 (5%) Query: 11 EDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLS 70 E N Y++L +++ A+ EEI Y++ + +HPD+H NK++ A++ F +++EAYE+LS Sbjct: 792 EKNSYRVLGLTEDATQEEIKKRYKKLAMKWHPDRHR--DNKEE-AQKHFMEIQEAYEILS 848 Query: 71 D-SHKRAIYDT 80 KRA +T Sbjct: 849 KLKTKRASKNT 859 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 48.8 bits (111), Expect = 1e-05 Identities = 20/66 (30%), Positives = 40/66 (60%), Gaps = 3/66 (4%) Query: 14 YYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDSH 73 +Y++L V + + YR+ + +HPDK+ + + + ++F ++++AY+VLSD Sbjct: 5 HYEVLGVERDVDDSALKKTYRKLALKWHPDKNLDNAEE---STRVFREIQQAYDVLSDPQ 61 Query: 74 KRAIYD 79 +RA YD Sbjct: 62 ERAFYD 67 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 48.0 bits (109), Expect = 2e-05 Identities = 25/70 (35%), Positives = 44/70 (62%), Gaps = 5/70 (7%) Query: 10 LEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVL 69 LED +Y LL+ + A+ E+IN+ +++ ++ +HPDK D + ++ F ++K+A +VL Sbjct: 286 LED-FYSLLDCGEYATNEQINTEFKKKAKEWHPDKKRNDTDSHEY----FARLKKARDVL 340 Query: 70 SDSHKRAIYD 79 D RA YD Sbjct: 341 CDEKMRAKYD 350 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 47.6 bits (108), Expect = 2e-05 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 7/60 (11%) Query: 15 YQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDSHK 74 Y +L + + AS+ EI YR S+ +HPDK + DP K F ++ +AYE +SD +K Sbjct: 1250 YAVLEIDRGASVAEIRRQYRSLSKKYHPDKETGDPRK-------FMRIAKAYEAVSDFNK 1302 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 44.8 bits (101), Expect = 2e-04 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 5/67 (7%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 N+Y ++ + TA+ EI SAY SR++HPD +S+ ++++AE + AY LS Sbjct: 51 NHYDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAE-----LTLAYNTLSRL 105 Query: 73 HKRAIYD 79 R YD Sbjct: 106 ETRREYD 112 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 44.8 bits (101), Expect = 2e-04 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 5/67 (7%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDS 72 N+Y ++ + TA+ EI SAY SR++HPD +S+ ++++AE + AY LS Sbjct: 198 NHYDVMKLLPTATQREIKSAYYELSRIYHPDLNSSAEARERFAE-----LTLAYNTLSRL 252 Query: 73 HKRAIYD 79 R YD Sbjct: 253 ETRREYD 259 >SB_44151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 41.1 bits (92), Expect = 0.002 Identities = 17/40 (42%), Positives = 26/40 (65%) Query: 461 LPGFYDPCVGEDKHLTVQYMFHNNLHCCTVPDNQAIVLPR 500 L GFYDPC +DK L ++Y F + LH T+ + + I +P+ Sbjct: 3 LSGFYDPCPYQDKLLRIRYEFRDALHEVTIGELETIRIPK 42 >SB_29448| Best HMM Match : DnaJ (HMM E-Value=0.00022) Length = 118 Score = 40.3 bits (90), Expect = 0.004 Identities = 16/42 (38%), Positives = 29/42 (69%) Query: 14 YYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWA 55 +Y ++ + TA+L EI SAY SR++HPD +S+ ++++A Sbjct: 76 HYDVMKLLPTATLREIKSAYYELSRIYHPDLNSSAEARERFA 117 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 36.3 bits (80), Expect = 0.062 Identities = 12/34 (35%), Positives = 24/34 (70%) Query: 12 DNYYQLLNVSKTASLEEINSAYRRFSRMFHPDKH 45 ++YY+L +S+ A+ +EI A+++ + HPDK+ Sbjct: 27 EDYYELFGISRDATSKEIRKAFKKLALRLHPDKN 60 >SB_24982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 35.1 bits (77), Expect = 0.14 Identities = 16/53 (30%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Query: 26 LEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDSHKRAIY 78 L+++ AYR+ HPDK + +P+ + A IF ++ EA+ + +S + +Y Sbjct: 482 LDDVKKAYRKAVLCVHPDKLTGEPH-EALARAIFMELNEAWSLFEESGCKPLY 533 >SB_57035| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 33.9 bits (74), Expect = 0.33 Identities = 28/107 (26%), Positives = 41/107 (38%), Gaps = 2/107 (1%) Query: 405 GKLPADTSSHVIPEQTGDGVSPESPSPYSDVIDVTIPVQCLVKDSRLELLEASKSELPGF 464 G D +S + P D S P Y C VK + L A LP Sbjct: 118 GDYLGDLTSELEPGDFIDRYSSTGPKSYGYTTQQGHST-CKVKGLHINLRTADIVNLPPC 176 Query: 465 YDPC-VGEDKHLTVQYMFHNNLHCCTVPDNQAIVLPRNIYMVDTEKG 510 ++ C V E++H+T+ Y N+H T+ A R +Y +G Sbjct: 177 WNSCAVAEERHVTLPYTIQRNVHDRTLHTVPAHKTFRVVYNKRVRRG 223 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 33.9 bits (74), Expect = 0.33 Identities = 13/41 (31%), Positives = 27/41 (65%), Gaps = 1/41 (2%) Query: 13 NYYQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQK 53 ++Y+ L + + A+ ++IN AY++ + + HPDK S P ++ Sbjct: 143 DHYERLGIQQGATKDDINRAYKKLAVLIHPDK-SVAPGSEE 182 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 31.9 bits (69), Expect = 1.3 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 17 LLNVSKTASLEEINSAYRRFSRMFHPDK---HSTDPNKQKWAEQIFNKVKEAYEVL 69 +L V T I AYR+ HPDK P + A+Q ++++AYE++ Sbjct: 79 VLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELI 134 >SB_14525| Best HMM Match : Phospholip_A2_1 (HMM E-Value=2.2) Length = 462 Score = 31.5 bits (68), Expect = 1.8 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 4/59 (6%) Query: 394 KKGLVILKALYGKLPADTSSHVIPEQTG---DGVSPESPSPYSDVIDVTIPVQCLVKDS 449 K+ + +LKAL G++ + SH + + + D S S SD+ + TI + C VKD+ Sbjct: 187 KRSMKLLKALQGRMRKENKSHNMADDSSGRKDTKSATICSKKSDITEQTIDIMC-VKDN 244 >SB_21811| Best HMM Match : DNA_pol_B_2 (HMM E-Value=3.7e-06) Length = 925 Score = 31.1 bits (67), Expect = 2.3 Identities = 36/163 (22%), Positives = 62/163 (38%), Gaps = 18/163 (11%) Query: 364 ERLQEMQRQARATVELMRETYSRIRSHEDKKKGLVILKALYGKLPADTSSHVIPEQTGDG 423 E+ QE++ + Y+R++ + D GL ++ + ++ SH E GD Sbjct: 754 EKFQELKPHTNVVIAAFITAYARLKLY-DVLDGLGE-RSSFSYTALESGSHPSGEYLGDL 811 Query: 424 VSPESPSPYSDVIDVTIPVQ-----------CLVKDSRLELLEASKSELPGF-----YDP 467 S P + D T P C VK + L A L ++ Sbjct: 812 TSELEPGDFIDRYSSTGPKSYGYTTQQGHSTCKVKGLHINLRTADIVNLTTMLELLRFEG 871 Query: 468 CVGEDKHLTVQYMFHNNLHCCTVPDNQAIVLPRNIYMVDTEKG 510 V E++H+T+ Y N+H T+ +A R +Y +G Sbjct: 872 AVAEERHVTLLYTIQRNVHDRTLHTMRAHKTFRVVYNKRVRRG 914 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 29.9 bits (64), Expect = 5.3 Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 15 YQLLNVSKTASLEEINSAYRRFSRMFHPDK 44 Y +L V AS ++I YR+ + + HPDK Sbjct: 802 YSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_55890| Best HMM Match : Filamin (HMM E-Value=0.02) Length = 264 Score = 29.9 bits (64), Expect = 5.3 Identities = 14/43 (32%), Positives = 27/43 (62%), Gaps = 3/43 (6%) Query: 48 DPNKQKWAEQIFNKVKEAYEVL--SDSHKRAIYDTLGKRGLEV 88 D ++ K E +++++ YE+L S +H+ YD LGK+ L++ Sbjct: 7 DRSRHKVTEY-YDRLESGYELLARSSNHRATYYDELGKKSLKI 48 >SB_47749| Best HMM Match : Plasmodium_HRP (HMM E-Value=0.068) Length = 814 Score = 29.5 bits (63), Expect = 7.1 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 5/78 (6%) Query: 303 TCSSQTIVVPIHLCEEVMPSPVFYATVVPLVSWM----ILKKIVLDPIAXXXXXXXXXXS 358 TC S V I LC + VF T WM +LKK++++ S Sbjct: 455 TCKSPR-VHSIILCNAFSDTSVFQQTATSSAFWMMPAFVLKKMIMNNFNTDIVDADIADS 513 Query: 359 MEANFERLQEMQRQARAT 376 ++ ERL+ M R A+ Sbjct: 514 IDFMVERLESMGRNELAS 531 >SB_45349| Best HMM Match : rve (HMM E-Value=6.1e-31) Length = 298 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 4/64 (6%) Query: 5 GESIL-LEDNY---YQLLNVSKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFN 60 GES+L + DNY Y+++ ++ T S + +N+ + F+R P +D Q +E+ Sbjct: 51 GESLLVIADNYSRFYEVVIMNSTTSHKVVNALTQVFARFRFPHSIKSDNGSQFVSEEFTR 110 Query: 61 KVKE 64 ++E Sbjct: 111 YLRE 114 >SB_41411| Best HMM Match : RVT_1 (HMM E-Value=0.00044) Length = 647 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/70 (25%), Positives = 30/70 (42%), Gaps = 4/70 (5%) Query: 10 LEDNYYQLLNVSKTASLEEINSAYRRFSRMFHPD-KHSTDPNKQKWAEQIFNKVKEAYEV 68 L+D +Y L + E + R+ R + K S +K+KW E+I EA + Sbjct: 189 LKDEFYTRLQERRVLESERVKGQLRKKYREKDREVKQSLKADKKKWLEEI---ASEAEKA 245 Query: 69 LSDSHKRAIY 78 H + +Y Sbjct: 246 ARSQHMKTLY 255 >SB_46805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 29.1 bits (62), Expect = 9.3 Identities = 16/40 (40%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Query: 206 TYRAGNQGSSMTSIYVRDSEKYHSNTAIQIGNPHSFISFN 245 TY N+ S T YV D+ H+ T I + NP F S N Sbjct: 11 TYTESNE--SATIFYVSDTAIAHTYTTITLANPQPFKSAN 48 >SB_27572| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.1e-19) Length = 3107 Score = 29.1 bits (62), Expect = 9.3 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 5/63 (7%) Query: 21 SKTASLEEINSAYRRFSRMFHPDKHSTDPNKQKWAEQIFNKVKEAYEVLSDSHKRAIYDT 80 +KT+ E NSAY++ R + + + Q+ AE++ V E + +D H + ++DT Sbjct: 2278 NKTSRAEAFNSAYQKKIRALNDELYEA----QQKAEKLQQTVSELQQT-ADEHSKDLHDT 2332 Query: 81 LGK 83 K Sbjct: 2333 RKK 2335 >SB_9147| Best HMM Match : Sushi (HMM E-Value=0) Length = 1656 Score = 29.1 bits (62), Expect = 9.3 Identities = 12/44 (27%), Positives = 27/44 (61%) Query: 214 SSMTSIYVRDSEKYHSNTAIQIGNPHSFISFNVMRKLPQHDLKL 257 S +++I+V DSE + ++ I + N F++++V+ + D +L Sbjct: 612 SVLSTIFVSDSELFVDDSVISVSNSVQFVNYSVLSTIFVSDSEL 655 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,454,785 Number of Sequences: 59808 Number of extensions: 658167 Number of successful extensions: 1692 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 11 Number of HSP's that attempted gapping in prelim test: 1617 Number of HSP's gapped (non-prelim): 57 length of query: 535 length of database: 16,821,457 effective HSP length: 86 effective length of query: 449 effective length of database: 11,677,969 effective search space: 5243408081 effective search space used: 5243408081 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 62 (29.1 bits)
- SilkBase 1999-2023 -