BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000581-TA|BGIBMGA000581-PA|IPR001623|Heat shock protein DnaJ, N-terminal (535 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 32 0.044 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 32 0.044 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 30 0.14 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 30 0.14 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 30 0.14 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 30 0.14 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 30 0.14 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 30 0.18 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 30 0.18 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 30 0.18 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 30 0.18 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 30 0.18 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 30 0.18 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 27 0.95 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 27 0.95 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 26 2.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 8.9 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 24 8.9 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 31.9 bits (69), Expect = 0.044 Identities = 13/28 (46%), Positives = 20/28 (71%) Query: 55 AEQIFNKVKEAYEVLSDSHKRAIYDTLG 82 AE F ++K++YE+LSDS +R +D G Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 31.9 bits (69), Expect = 0.044 Identities = 13/28 (46%), Positives = 20/28 (71%) Query: 55 AEQIFNKVKEAYEVLSDSHKRAIYDTLG 82 AE F ++K++YE+LSDS +R +D G Sbjct: 2 AETRFVEIKQSYELLSDSERRRAFDQYG 29 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 30.3 bits (65), Expect = 0.14 Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 56 EQIFNKVKEAYEVLSDSHKRAIYDTLG 82 E F ++K++YE+LSDS +R +D G Sbjct: 1 ETRFVEIKQSYELLSDSERRRAFDQYG 27 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 29.9 bits (64), Expect = 0.18 Identities = 11/24 (45%), Positives = 18/24 (75%) Query: 59 FNKVKEAYEVLSDSHKRAIYDTLG 82 F ++K++YE+LSDS +R +D G Sbjct: 3 FVEIKQSYELLSDSERRRAFDQYG 26 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 29.9 bits (64), Expect = 0.18 Identities = 31/124 (25%), Positives = 52/124 (41%), Gaps = 7/124 (5%) Query: 411 TSSHVIPEQTGDGVSPESPSPYSDVIDVTIPVQCLVKDSRLELLEA-SKSELPGFYDPCV 469 T + +T V PES + ++ T+P+ + ELL+A S + L Sbjct: 514 TEEPALEPETIMAVEPESTTLMEELPTTTVPITDAITPDDTELLQASSNTNLKTVLR--A 571 Query: 470 GEDKHLTVQYMFHNNLHCCTVPDNQAIVLPRNIYMVDTEKGAADGLGPRTAETANSPPSR 529 E +H T + N + VP+++ I P ++ VD KG AE N P Sbjct: 572 EEVRHRTKRQSRTVNFNAIVVPESKHI--PLKVFHVD--KGRRYRFRLINAEFLNCPVEL 627 Query: 530 TLKN 533 +++N Sbjct: 628 SIEN 631 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 27.5 bits (58), Expect = 0.95 Identities = 17/69 (24%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Query: 418 EQTGDGVSPESPSPYSDVIDVTIPVQCLVKDSRLELLEASKSELPGFYDPCVGEDKHLTV 477 E + DG P SP + +++ P + L+ D+R A + G C + Sbjct: 293 EASSDGSPPRSPEGSHEEVEMDEPKKILIVDAR-SYTSAVTNRARGGGCECAEYYPSAEI 351 Query: 478 QYMFHNNLH 486 Q+M N+H Sbjct: 352 QFMSLGNIH 360 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 27.5 bits (58), Expect = 0.95 Identities = 17/69 (24%), Positives = 29/69 (42%), Gaps = 1/69 (1%) Query: 418 EQTGDGVSPESPSPYSDVIDVTIPVQCLVKDSRLELLEASKSELPGFYDPCVGEDKHLTV 477 E + DG P SP + +++ P + L+ D+R A + G C + Sbjct: 293 EASSDGSPPRSPEGSHEEVEMDEPKKILIVDAR-SYTSAVTNRARGGGCECAEYYPSAEI 351 Query: 478 QYMFHNNLH 486 Q+M N+H Sbjct: 352 QFMSLGNIH 360 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 26.2 bits (55), Expect = 2.2 Identities = 16/39 (41%), Positives = 22/39 (56%) Query: 359 MEANFERLQEMQRQARATVELMRETYSRIRSHEDKKKGL 397 MEA+ E+L+E QR+AR E R + R K+K L Sbjct: 103 MEASNEQLKEAQREAREAREDARVREAEHREELRKEKEL 141 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 24.2 bits (50), Expect = 8.9 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Query: 264 GTFGAIAEYGAEKKVSQNSS---VSAAVMLGVPSGVMLKLKWT 303 GT GA A V+ +S V AA G+PSG LKL+ T Sbjct: 1512 GTDGAAAAPTGGAAVTNATSILQVYAAYETGLPSGTSLKLRVT 1554 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 24.2 bits (50), Expect = 8.9 Identities = 10/33 (30%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Query: 28 EINSAYRRFSRMFHPDKHSTDPNKQ---KWAEQ 57 ++N +R+ + + P + DPN+ WAEQ Sbjct: 237 QVNRLWRKTRKAYGPFCYGADPNRNWDFHWAEQ 269 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 509,471 Number of Sequences: 2123 Number of extensions: 20605 Number of successful extensions: 83 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 35 Number of HSP's gapped (non-prelim): 50 length of query: 535 length of database: 516,269 effective HSP length: 67 effective length of query: 468 effective length of database: 374,028 effective search space: 175045104 effective search space used: 175045104 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -