Silkworm BLAST Result against spombe

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000580-TA|BGIBMGA000580-PA|undefined
         (247 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC74.02c |||mRNA cleavage and polyadenylation specificity fact...    26   5.9  

>SPCC74.02c |||mRNA cleavage and polyadenylation specificity factor
           complex associated protein|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 710

 Score = 25.8 bits (54), Expect = 5.9
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 1/58 (1%)

Query: 135 NAHFVSNITKNDVRTTTDLHTS-SICFSEGNDKAKLKLTLSSNQRKAAVQSTQPCNGN 191
           NA F S+   ND +T        S+ +   ND  ++K   S N+  AA   T    GN
Sbjct: 484 NAVFSSDPASNDEKTGNKKRKKKSVSWKPDNDLVQVKFIESLNEEGAASVKTPHIYGN 541


  Database: spombe
    Posted date:  Oct 3, 2007  3:31 PM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.319    0.131    0.370 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 764,881
Number of Sequences: 5004
Number of extensions: 19878
Number of successful extensions: 41
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 41
Number of HSP's gapped (non-prelim): 1
length of query: 247
length of database: 2,362,478
effective HSP length: 71
effective length of query: 176
effective length of database: 2,007,194
effective search space: 353266144
effective search space used: 353266144
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.8 bits)
S2: 53 (25.4 bits)