BLASTP 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.
Query= BGIBMGA000576-TA|BGIBMGA000576-PA|undefined
         (51 letters)
Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value
UniRef50_Q0EYG1 Cluster: Surface antigen; n=1; Mariprofundus fer...    31   5.8  
>UniRef50_Q0EYG1 Cluster: Surface antigen; n=1; Mariprofundus
           ferrooxydans PV-1|Rep: Surface antigen - Mariprofundus
           ferrooxydans PV-1
          Length = 645
 Score = 30.7 bits (66), Expect = 5.8
 Identities = 14/35 (40%), Positives = 19/35 (54%)
Query: 11  GERFRERRETIVLMTPLMMELFGEEYQRNIRGEYG 45
           G  F +R + I+        LFG+ YQ NI G+YG
Sbjct: 438 GIGFSQREKVILTAKIAESNLFGKGYQANINGQYG 472
  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.326    0.144    0.435 
Gapped
Lambda     K      H
   0.279   0.0580    0.190 
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 53,867,439
Number of Sequences: 1657284
Number of extensions: 1404461
Number of successful extensions: 4048
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 4047
Number of HSP's gapped (non-prelim): 1
length of query: 51
length of database: 575,637,011
effective HSP length: 32
effective length of query: 19
effective length of database: 522,603,923
effective search space: 9929474537
effective search space used: 9929474537
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.6 bits)
S2: 65 (30.3 bits)
- SilkBase 1999-2023 -