BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000576-TA|BGIBMGA000576-PA|undefined (51 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q0EYG1 Cluster: Surface antigen; n=1; Mariprofundus fer... 31 5.8 >UniRef50_Q0EYG1 Cluster: Surface antigen; n=1; Mariprofundus ferrooxydans PV-1|Rep: Surface antigen - Mariprofundus ferrooxydans PV-1 Length = 645 Score = 30.7 bits (66), Expect = 5.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Query: 11 GERFRERRETIVLMTPLMMELFGEEYQRNIRGEYG 45 G F +R + I+ LFG+ YQ NI G+YG Sbjct: 438 GIGFSQREKVILTAKIAESNLFGKGYQANINGQYG 472 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.326 0.144 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,867,439 Number of Sequences: 1657284 Number of extensions: 1404461 Number of successful extensions: 4048 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4047 Number of HSP's gapped (non-prelim): 1 length of query: 51 length of database: 575,637,011 effective HSP length: 32 effective length of query: 19 effective length of database: 522,603,923 effective search space: 9929474537 effective search space used: 9929474537 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 65 (30.3 bits)
- SilkBase 1999-2023 -