BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000576-TA|BGIBMGA000576-PA|undefined (51 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. 21 0.71 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 19 2.9 >DQ414247-1|ABD63009.2| 414|Tribolium castaneum paired protein. Length = 414 Score = 21.4 bits (43), Expect = 0.71 Identities = 12/43 (27%), Positives = 17/43 (39%) Query: 4 KILCWVLGERFRERRETIVLMTPLMMELFGEEYQRNIRGEYGD 46 +I W R R R++ TPL+ E Y +G D Sbjct: 263 RIQVWFSNRRARLRKQITSAATPLVRSYAPERYPPLAQGVNDD 305 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 19.4 bits (38), Expect = 2.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Query: 3 TKILCWVLGERFRER 17 T LC+ L E+F ER Sbjct: 305 TVFLCYKLMEKFPER 319 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.326 0.144 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,991 Number of Sequences: 317 Number of extensions: 282 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 51 length of database: 114,650 effective HSP length: 32 effective length of query: 19 effective length of database: 104,506 effective search space: 1985614 effective search space used: 1985614 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 34 (18.8 bits) S2: 34 (17.8 bits)
- SilkBase 1999-2023 -