BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000576-TA|BGIBMGA000576-PA|undefined (51 letters) Database: fruitfly 52,641 sequences; 24,830,863 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Y18048-1|CAB41881.1| 250|Drosophila melanogaster deoxynucleosid... 25 9.7 AY102689-1|AAM27518.1| 250|Drosophila melanogaster LD27103p pro... 25 9.7 AF185268-1|AAD56545.1| 250|Drosophila melanogaster deoxyribonuc... 25 9.7 AF045610-1|AAD47355.2| 250|Drosophila melanogaster deoxyribonuc... 25 9.7 AE014297-2606|AAF55615.1| 250|Drosophila melanogaster CG5452-PA... 25 9.7 >Y18048-1|CAB41881.1| 250|Drosophila melanogaster deoxynucleoside kinase protein. Length = 250 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 8 WVLGERFRERRETIVLMTPLMMELFGEEYQRN 39 W++ +R + + +VL L +E G EYQR+ Sbjct: 190 WLIHQRRPQSCKVLVLDADLNLENIGTEYQRS 221 >AY102689-1|AAM27518.1| 250|Drosophila melanogaster LD27103p protein. Length = 250 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 8 WVLGERFRERRETIVLMTPLMMELFGEEYQRN 39 W++ +R + + +VL L +E G EYQR+ Sbjct: 190 WLIHQRRPQSCKVLVLDADLNLENIGTEYQRS 221 >AF185268-1|AAD56545.1| 250|Drosophila melanogaster deoxyribonucleoside kinase protein. Length = 250 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 8 WVLGERFRERRETIVLMTPLMMELFGEEYQRN 39 W++ +R + + +VL L +E G EYQR+ Sbjct: 190 WLIHQRRPQSCKVLVLDADLNLENIGTEYQRS 221 >AF045610-1|AAD47355.2| 250|Drosophila melanogaster deoxyribonucleoside kinase protein. Length = 250 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 8 WVLGERFRERRETIVLMTPLMMELFGEEYQRN 39 W++ +R + + +VL L +E G EYQR+ Sbjct: 190 WLIHQRRPQSCKVLVLDADLNLENIGTEYQRS 221 >AE014297-2606|AAF55615.1| 250|Drosophila melanogaster CG5452-PA protein. Length = 250 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 8 WVLGERFRERRETIVLMTPLMMELFGEEYQRN 39 W++ +R + + +VL L +E G EYQR+ Sbjct: 190 WLIHQRRPQSCKVLVLDADLNLENIGTEYQRS 221 Database: fruitfly Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 24,830,863 Number of sequences in database: 52,641 Lambda K H 0.326 0.144 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,328,519 Number of Sequences: 52641 Number of extensions: 61750 Number of successful extensions: 141 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 136 Number of HSP's gapped (non-prelim): 5 length of query: 51 length of database: 24,830,863 effective HSP length: 32 effective length of query: 19 effective length of database: 23,146,351 effective search space: 439780669 effective search space used: 439780669 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.6 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -