BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000575-TA|BGIBMGA000575-PA|undefined (105 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0656 + 5652383-5653009,5653260-5653736,5654969-5655289,565... 26 5.0 04_03_0914 + 20788103-20789642,20790036-20790529 26 6.6 02_05_0975 + 33227431-33227730,33228556-33228636,33228883-332296... 26 6.6 01_05_0478 - 22587881-22588021,22588126-22588266,22588436-225886... 26 6.6 11_01_0450 - 3487464-3487844,3487883-3488268,3488883-3489033,348... 25 8.8 10_08_0960 - 21853010-21853282,21854078-21854449,21854555-218548... 25 8.8 >08_01_0656 + 5652383-5653009,5653260-5653736,5654969-5655289, 5655434-5655589,5656062-5656127,5656196-5656315 Length = 588 Score = 26.2 bits (55), Expect = 5.0 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Query: 60 AEISKDTEKSIESNAHSSIHIAPDDKEPQNQVVEHYGESSRQV 102 +EI+ D + + H H DD + +NQ EH GE Q+ Sbjct: 405 SEIADDYDDEKQRQEHCEGHNPIDDYDDENQHEEH-GEEHNQI 446 >04_03_0914 + 20788103-20789642,20790036-20790529 Length = 677 Score = 25.8 bits (54), Expect = 6.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Query: 21 NTPANMSDNQLNTHGSSKIFTM 42 NTP + ++N+ TH S K ++M Sbjct: 340 NTPIDCTNNKNTTHSSDKFYSM 361 >02_05_0975 + 33227431-33227730,33228556-33228636,33228883-33229680, 33230829-33231005,33231159-33231274,33231422-33231520, 33231598-33232040,33232147-33232184,33232343-33232600, 33233378-33233525,33233989-33234108,33234884-33234984, 33235090-33235213,33235386-33235498,33236103-33236214, 33236298-33236432,33236527-33236593,33236685-33236741, 33236774-33236900,33237221-33237338,33237418-33237929 Length = 1347 Score = 25.8 bits (54), Expect = 6.6 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Query: 61 EISKDTEKSIESNAHSSIHIAPDDKE-PQNQVVEHYGESSR 100 ++S T+++ +NA ++ HI PD E P ++ E E +R Sbjct: 1207 DVSPGTDQNQRTNAEANDHIDPDKMEVPDSEDEEAVHEDTR 1247 >01_05_0478 - 22587881-22588021,22588126-22588266,22588436-22588643, 22589199-22589238,22589425-22589647,22590826-22590970, 22591053-22591156,22591298-22591396,22591506-22591684, 22591948-22592167 Length = 499 Score = 25.8 bits (54), Expect = 6.6 Identities = 13/45 (28%), Positives = 23/45 (51%), Gaps = 2/45 (4%) Query: 60 AEISKDTEKSIESNAHSSIHIAPDDKEPQNQVVEHYGESSRQVKM 104 +E SK T+K+ + +H + DD + N+ +H SR+ M Sbjct: 317 SETSKKTDKAHRKDKELPVHRSDDDNDDDNE--DHQLTKSRKFSM 359 >11_01_0450 - 3487464-3487844,3487883-3488268,3488883-3489033, 3489132-3491102,3492090-3492149,3492240-3492436, 3492678-3492963 Length = 1143 Score = 25.4 bits (53), Expect = 8.8 Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 66 TEKSIESNAHSSIHIAPDDKEPQNQVVEHYGESS 99 T S E+ A S I +AP+D E + + E+ E S Sbjct: 487 TLTSNENFAQSKIFVAPEDSESEGTISENLFEIS 520 >10_08_0960 - 21853010-21853282,21854078-21854449,21854555-21854862, 21854946-21855102 Length = 369 Score = 25.4 bits (53), Expect = 8.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Query: 64 KDTEKSIESNAHSSIHIAPDDKEPQNQ 90 +DTE+ I+ A + PDDKE Q Sbjct: 306 EDTEEMIQEGAEEEEVLEPDDKEADAQ 332 Database: rice Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.306 0.119 0.327 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,321,538 Number of Sequences: 37544 Number of extensions: 52915 Number of successful extensions: 125 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 122 Number of HSP's gapped (non-prelim): 6 length of query: 105 length of database: 14,793,348 effective HSP length: 72 effective length of query: 33 effective length of database: 12,090,180 effective search space: 398975940 effective search space used: 398975940 T: 11 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.6 bits) S2: 53 (25.4 bits)
- SilkBase 1999-2023 -