BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000574-TA|BGIBMGA000574-PA|IPR002110|Ankyrin (218 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 3.3 AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. 22 4.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 21 5.7 EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D pro... 21 7.6 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.2 bits (45), Expect = 3.3 Identities = 15/44 (34%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Query: 101 MDTSLSPGSYRKKEGFLRIGSLNVRV----KKTTEAFSNFLGVG 140 +D +L G Y K+EG L + V++ K TT A + VG Sbjct: 312 IDGALEAGPYSKEEGLLSYPEVCVKLANPQKLTTAAGKHLRKVG 355 >AY321476-2|AAQ23387.1| 257|Tribolium castaneum Ase protein. Length = 257 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/16 (50%), Positives = 12/16 (75%) Query: 98 LVHMDTSLSPGSYRKK 113 L+H+ SLSPG Y ++ Sbjct: 188 LLHVSDSLSPGIYSEQ 203 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 21.4 bits (43), Expect = 5.7 Identities = 8/16 (50%), Positives = 10/16 (62%) Query: 95 RQYLVHMDTSLSPGSY 110 +Q+L H LSPG Y Sbjct: 114 QQHLYHPQVLLSPGGY 129 >EF125547-1|ABL73931.1| 255|Tribolium castaneum obstractor D protein. Length = 255 Score = 21.0 bits (42), Expect = 7.6 Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 47 TCRRRWKQNGGYTPL 61 +C R W+ GGY L Sbjct: 169 SCNRYWQCQGGYPRL 183 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.320 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 48,570 Number of Sequences: 317 Number of extensions: 2039 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 218 length of database: 114,650 effective HSP length: 54 effective length of query: 164 effective length of database: 97,532 effective search space: 15995248 effective search space used: 15995248 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -