BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000573-TA|BGIBMGA000573-PA|undefined (263 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 6.8 AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. 23 6.8 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 6.8 Identities = 9/28 (32%), Positives = 16/28 (57%) Query: 2 SAPTELSFDEILKFMLAHNGKVTNHELV 29 +AP ++ D ++ F + +GKV LV Sbjct: 1962 NAPERVNMDRVVHFTYSSHGKVMREALV 1989 >AJ304412-1|CAC39105.1| 196|Anopheles gambiae dynamin protein. Length = 196 Score = 23.4 bits (48), Expect = 6.8 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Query: 69 ILKKKYMPNNGKDMEEVSETKAESPHVG-SLDTQLE 103 + +K P NG D E E+ ES G SLD QLE Sbjct: 61 VYPEKDTPANG-DETEAEESGGESGPTGQSLDPQLE 95 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.312 0.125 0.341 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,638 Number of Sequences: 2123 Number of extensions: 6652 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 2 length of query: 263 length of database: 516,269 effective HSP length: 63 effective length of query: 200 effective length of database: 382,520 effective search space: 76504000 effective search space used: 76504000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits) S2: 47 (23.0 bits)
- SilkBase 1999-2023 -