BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000572-TA|BGIBMGA000572-PA|IPR000577|Carbohydrate kinase, FGGY, IPR005999|Glycerol kinase (431 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 23 5.0 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 6.6 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 8.7 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 22 8.7 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 8.7 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 23.0 bits (47), Expect = 5.0 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Query: 290 WRQDARGVICGITEDTNSNHIV-KAALEAVCFQVRD 324 +R D GVI +TEDT + K ++ + F +D Sbjct: 231 FRTDTAGVIKKLTEDTQERRLSNKGSISKLQFHNKD 266 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 6.6 Identities = 9/19 (47%), Positives = 13/19 (68%) Query: 193 GGKHVTDVTNASRTMLMNI 211 GGK +T ++ S TM +NI Sbjct: 325 GGKTLTSISVESNTMFINI 343 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 71 ENLVALGGNPEDIIAVGVT 89 EN+ GGNP+ I +G++ Sbjct: 191 ENIEWFGGNPKRITLIGLS 209 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 71 ENLVALGGNPEDIIAVGVT 89 EN+ GGNP+ I +G++ Sbjct: 62 ENIEWFGGNPKRITLIGLS 80 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 8.7 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 71 ENLVALGGNPEDIIAVGVT 89 EN+ GGNP+ I +G++ Sbjct: 191 ENIEWFGGNPKRITLIGLS 209 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.317 0.134 0.408 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,167 Number of Sequences: 429 Number of extensions: 5044 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 10 Number of HSP's gapped (non-prelim): 5 length of query: 431 length of database: 140,377 effective HSP length: 60 effective length of query: 371 effective length of database: 114,637 effective search space: 42530327 effective search space used: 42530327 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -