GeneModel BLAST Result against tribolium

BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000572-TA|BGIBMGA000572-PA|IPR000577|Carbohydrate
kinase, FGGY, IPR005999|Glycerol kinase
         (431 letters)

Database: tribolium 
           317 sequences; 114,650 total letters

Searching....................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    25   1.4  

>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 24.6 bits (51), Expect = 1.4
 Identities = 10/39 (25%), Positives = 23/39 (58%)

Query: 79  NPEDIIAVGVTNQRETTIVWEQGTGKPLYNAIVWLDMRT 117
           N  + +A G+T Q+ T   + +  G P++  +V++ M++
Sbjct: 171 NRYETVAHGMTVQKTTLFFFNRTFGVPIFLVLVFVQMQS 209


  Database: tribolium
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 114,650
  Number of sequences in database:  317
  
Lambda     K      H
   0.317    0.134    0.408 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 100,843
Number of Sequences: 317
Number of extensions: 4350
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 3
Number of HSP's gapped (non-prelim): 1
length of query: 431
length of database: 114,650
effective HSP length: 59
effective length of query: 372
effective length of database: 95,947
effective search space: 35692284
effective search space used: 35692284
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
S2: 44 (21.8 bits)