BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000570-TA|BGIBMGA000570-PA|IPR001452|Src homology-3, IPR006020|Phosphotyrosine interaction region (422 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54348| Best HMM Match : No HMM Matches (HMM E-Value=.) 79 5e-15 SB_27365| Best HMM Match : PID (HMM E-Value=1.90001e-40) 55 1e-07 SB_51281| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_49450| Best HMM Match : SH3_1 (HMM E-Value=6.9e-17) 47 3e-05 SB_38286| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 3e-05 SB_37706| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 8e-05 SB_3027| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) 41 0.002 SB_9817| Best HMM Match : PID (HMM E-Value=1.2e-20) 41 0.002 SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) 40 0.005 SB_34642| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) 39 0.009 SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) 38 0.015 SB_11486| Best HMM Match : SH3_1 (HMM E-Value=0.0037) 38 0.015 SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) 36 0.062 SB_5826| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.11 SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) 34 0.19 SB_27031| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.25 SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.25 SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.33 SB_8979| Best HMM Match : SH3_1 (HMM E-Value=3.6e-05) 33 0.33 SB_39120| Best HMM Match : SH3_1 (HMM E-Value=2e-20) 33 0.44 SB_52289| Best HMM Match : SH3_1 (HMM E-Value=3.5e-13) 33 0.44 SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41) 33 0.58 SB_48483| Best HMM Match : SH3_1 (HMM E-Value=7.1e-23) 33 0.58 SB_42788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.58 SB_51657| Best HMM Match : SH3_1 (HMM E-Value=2.69999e-40) 33 0.58 SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) 32 0.76 SB_27192| Best HMM Match : SH3_1 (HMM E-Value=0.53) 32 1.0 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 32 1.0 SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.3 SB_19980| Best HMM Match : rve (HMM E-Value=0.91) 30 3.1 SB_44865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 4.1 SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 4.1 SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.1 SB_33954| Best HMM Match : Ion_trans_2 (HMM E-Value=0.74) 29 9.4 >SB_54348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 79.4 bits (187), Expect = 5e-15 Identities = 34/64 (53%), Positives = 42/64 (65%) Query: 201 SQLEMLEATHRGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 S L+ TH HKF RH+DEI ++ GDP+ V + EDLWCEG NLRTGQ G+FPS Y Sbjct: 175 SPTSQLKQTHVATHKFIMRHNDEINLDEGDPMMVYQTCEDLWCEGTNLRTGQCGVFPSRY 234 Query: 261 AVDM 264 + Sbjct: 235 VASI 238 >SB_27365| Best HMM Match : PID (HMM E-Value=1.90001e-40) Length = 837 Score = 54.8 bits (126), Expect = 1e-07 Identities = 36/139 (25%), Positives = 65/139 (46%), Gaps = 15/139 (10%) Query: 281 YLLGYMGSVETLAHKGTGVVCQAVKKIV-------GECSTEPT-IQPCILEVSDQGLRMV 332 Y + + G E KGT V+ +A+ K+ E T+ + ++ L+++ G+ + Sbjct: 34 YTVKFYGVTEVAEAKGTEVIKEAITKVQFANHIKKSEAGTKASKLRKVDLKINIDGVSIE 93 Query: 333 DRSKPERNRNGPCIDYFYSLKNVSFCAFHPRDHRYLGFITKHPTLQRFACHVFRGQESTR 392 D E + + Y L ++S+CA R+ R FI K T + C+VF + Sbjct: 94 DSKSKE-------VLHSYPLHHISYCADDKRNKRVFAFIAKDKTSPKHTCYVFEAERLAE 146 Query: 393 PVAEAVGRAFQRFYQKFIE 411 + VG+AF Y++F+E Sbjct: 147 ELTLTVGQAFDLAYRRFLE 165 >SB_51281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 48.0 bits (109), Expect = 1e-05 Identities = 21/43 (48%), Positives = 28/43 (65%) Query: 356 SFCAFHPRDHRYLGFITKHPTLQRFACHVFRGQESTRPVAEAV 398 S+ ++ + RY FITKHP RFACHVF + ST PVA ++ Sbjct: 13 SWESYSTKIKRYFAFITKHPEEPRFACHVFMSEFSTEPVAYSI 55 >SB_49450| Best HMM Match : SH3_1 (HMM E-Value=6.9e-17) Length = 288 Score = 46.8 bits (106), Expect = 3e-05 Identities = 18/57 (31%), Positives = 37/57 (64%) Query: 204 EMLEATHRGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 E+ + + L+ + P+ DE+E++ G+ YV ++ +D W +GV+L + ++G+FP Y Sbjct: 67 EIGKELYTALYNYKPQKEDELELKQGECYYVLEKCKDGWFKGVSLHSQKRGVFPGNY 123 >SB_38286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 288 Score = 46.8 bits (106), Expect = 3e-05 Identities = 18/57 (31%), Positives = 37/57 (64%) Query: 204 EMLEATHRGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 E+ + + L+ + P+ DE+E++ G+ YV ++ +D W +GV+L + ++G+FP Y Sbjct: 67 EIGKELYTALYNYKPQKEDELELKQGECYYVLEKCKDGWFKGVSLHSQKRGVFPGNY 123 >SB_37706| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 45.6 bits (103), Expect = 8e-05 Identities = 19/32 (59%), Positives = 22/32 (68%) Query: 367 YLGFITKHPTLQRFACHVFRGQESTRPVAEAV 398 Y FITKHP RFACHVF + ST PVA ++ Sbjct: 2 YFAFITKHPEEPRFACHVFMSEFSTEPVAYSI 33 >SB_3027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 886 Score = 42.3 bits (95), Expect = 7e-04 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 1/52 (1%) Query: 213 LHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY-AVD 263 +H+F DEI+++ GD + V K+ +D W GV R Q G FP + A+D Sbjct: 11 IHEFQTTRDDEIDLQKGDVVLVVKKYQDGWFRGVRCRGYQVGCFPGNFVAID 62 >SB_32226| Best HMM Match : PID (HMM E-Value=3.9e-30) Length = 591 Score = 40.7 bits (91), Expect = 0.002 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 11/125 (8%) Query: 285 YMGSVETLAHKGTGVVCQAVKKIVGECSTEPTIQPCILEVSDQGLRMVDRSKPERNRNGP 344 Y+G++E +GT V +A +K+ E + +L SD +R+VD Sbjct: 124 YVGAIEVTESRGTQVCAEAFRKM-REAGVHKKKRMNLLVTSDC-IRVVDEETK------- 174 Query: 345 CIDYFYSLKNVSFCAFHPRDHRYLGFITKHPTLQRFACHVFRG-QESTRPVAEAVGRAFQ 403 + ++K V FC P D R +I + T +R+ CH F +++ ++ AVG AF Sbjct: 175 VVLPLTTIKGV-FCTPDPSDDRVFSYICREGTTRRWMCHCFIAIRDTGERLSHAVGCAFT 233 Query: 404 RFYQK 408 Q+ Sbjct: 234 ACLQR 238 >SB_9817| Best HMM Match : PID (HMM E-Value=1.2e-20) Length = 144 Score = 40.7 bits (91), Expect = 0.002 Identities = 29/116 (25%), Positives = 53/116 (45%), Gaps = 15/116 (12%) Query: 281 YLLGYMGSVETLAHKGTGVVCQAVKKIV-------GECSTEPT-IQPCILEVSDQGLRMV 332 Y + + G E KGT V+ +A+ K+ E T+ + ++ L+++ G+ + Sbjct: 34 YTVKFYGVTEVAEAKGTEVIKEAITKVQFANHIKKSEAGTKASKLRKVDLKINIDGVSIE 93 Query: 333 DRSKPERNRNGPCIDYFYSLKNVSFCAFHPRDHRYLGFITKHPTLQRFACHVFRGQ 388 D E + + Y L ++S+CA R+ R FI K T + C+VF + Sbjct: 94 DSKSKE-------VLHSYPLHHISYCADDKRNKRVFAFIAKDKTSPKHTCYVFEAE 142 >SB_9732| Best HMM Match : SH3_1 (HMM E-Value=2e-17) Length = 1860 Score = 39.5 bits (88), Expect = 0.005 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Query: 211 RGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVDMDYNDFD 270 + +H + P+ DE+ + GD I V ++ D W G L G QG FP+ + ++ N+ Sbjct: 937 QAIHNYTPQQPDELALHEGDVINVLRKLPDGWYHGERLCDGVQGWFPANHTENI-RNEHI 995 Query: 271 PANAKVKRERYL 282 A ++R R L Sbjct: 996 RARNLLQRYRLL 1007 >SB_34642| Best HMM Match : SH3_1 (HMM E-Value=1.7e-14) Length = 237 Score = 38.7 bits (86), Expect = 0.009 Identities = 34/116 (29%), Positives = 51/116 (43%), Gaps = 10/116 (8%) Query: 148 LLDEDSSPDSERLQSLG-DVDSGHSTAHS-PIDTGPKS-LSPIPLQQNGNMTTVPHSQLE 204 L E + ++ R+Q L V S +H P D P + P PLQQ VP Sbjct: 124 LAGESNLENARRMQGLAATVQEELSKSHQRPCDDQPAAPYQPAPLQQ------VPQPSSS 177 Query: 205 MLEATHRGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 A + ++ +N DE+ + GD I + ++ W G RTGQ G+ P+ Y Sbjct: 178 N-SAQYLVMYDYNAADDDEVSMVEGDIIVDAEIIDEGWMVGRVKRTGQSGMLPANY 232 >SB_24368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1045 Score = 37.9 bits (84), Expect = 0.015 Identities = 17/39 (43%), Positives = 25/39 (64%) Query: 221 HDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSA 259 ++ I VE GD I+ ++ +D W G NL TG+ G FPS+ Sbjct: 25 NNPISVERGDIIFDVRKLDDGWLTGKNLNTGRSGRFPSS 63 >SB_37165| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 1034 Score = 37.9 bits (84), Expect = 0.015 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 204 EMLEATH-RGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAV 262 E L+ T L+ F R+ DE+ +G I V K+ ++ W EG G G+FP +Y Sbjct: 200 ENLDITFAEALYGFEARNKDELSFPMGAEIVVTKDVDNDWYEGT--FEGDTGLFPKSYVR 257 Query: 263 DMD 265 MD Sbjct: 258 IMD 260 >SB_11486| Best HMM Match : SH3_1 (HMM E-Value=0.0037) Length = 103 Score = 37.9 bits (84), Expect = 0.015 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Query: 222 DEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVD 263 +EI++E+GD I + D + +G N RTGQ G++PS Y V+ Sbjct: 49 EEIDLEVGDLIGIAGNHWDGYSKGTNHRTGQMGLYPS-YKVE 89 >SB_10902| Best HMM Match : SH3_1 (HMM E-Value=0) Length = 824 Score = 35.9 bits (79), Expect = 0.062 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Query: 216 FNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVD 263 + P H DE+++ GD I+V ++ D W +G + T +QG FPS YA D Sbjct: 213 YQPIHVDELQLTKGDLIHVLEKEGDGWWKGF-IGT-RQGWFPSNYAED 258 >SB_5826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 35.1 bits (77), Expect = 0.11 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 4/51 (7%) Query: 211 RGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEG-VNLRTGQQGIFPSAY 260 R L+ F PR ++ + GD +Y+ ++ ++ W EG VN G QG PS Y Sbjct: 209 RVLYDFEPREQGDLALCKGDFVYLLRQVDENWFEGQVN---GCQGFLPSNY 256 >SB_50893| Best HMM Match : SH3_1 (HMM E-Value=2e-33) Length = 665 Score = 34.3 bits (75), Expect = 0.19 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Query: 213 LHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVDMDYNDFDPA 272 L + + DE+ + G I V +E ED W EG G++G+FPS + V + D P Sbjct: 11 LFDYEAENADELSLVTGIEINVIREVEDGWWEGT--VDGRKGVFPSNF-VKLKPIDETPT 67 Query: 273 NAKVKRER 280 K + E+ Sbjct: 68 KTKRQPEK 75 Score = 31.1 bits (67), Expect = 1.8 Identities = 23/93 (24%), Positives = 43/93 (46%), Gaps = 9/93 (9%) Query: 171 STAHSPIDTGPKSLSPIPLQQNGNMTTVPHSQLEMLEATHRGLHKFNPRHHDEIEVEIGD 230 + +HS + + P+P P ++ + T+ + ++ DE+E+++GD Sbjct: 184 TASHSLGSSMKRKAPPVPPSPQPQEAQAPAKRVLRAKVTY----DYEQQNEDELELKVGD 239 Query: 231 PI-YVQKEAEDL--WCEGVNLRTGQQGIFPSAY 260 I V+KE D W EG G+ G+FP + Sbjct: 240 IITIVKKEVFDTPGWMEGE--LDGKTGLFPDNF 270 >SB_27031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 33.9 bits (74), Expect = 0.25 Identities = 14/44 (31%), Positives = 29/44 (65%), Gaps = 1/44 (2%) Query: 375 PTLQRFACHVFRGQESTRPVAEAVGRAFQRFYQKFIETAYPIED 418 P + + CHVF+ E+ + +A+++G++F YQ+F+++ ED Sbjct: 162 PKMIKITCHVFQADEA-QVIAKSIGQSFNVAYQEFLKSNGISED 204 >SB_30637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 33.9 bits (74), Expect = 0.25 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 208 ATHRGLHKFNPRHHDEIEVEIGDPIYVQK--EAEDLWCEGVNLRTGQQGIFPSAY 260 A + + + P EI + GD + V K E+ + W G N RTGQ G FP Y Sbjct: 6 AKFQASYAYVPADDKEIPLAPGDFLVVAKPFESAEGWLVGRNNRTGQYGEFPGTY 60 >SB_36215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1427 Score = 33.5 bits (73), Expect = 0.33 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Query: 211 RGLHKFNPRHHDEIEVEIGDPI-YVQKEAEDLWCEGVNLRTGQQGIFPS 258 R +H ++ + + E GD I ++ A+ W G N +TG+ G+FP+ Sbjct: 384 RAVHGYDSKSPQNLCFEEGDKITLIEASADTSWWRGQNKKTGRVGMFPA 432 >SB_8979| Best HMM Match : SH3_1 (HMM E-Value=3.6e-05) Length = 169 Score = 33.5 bits (73), Expect = 0.33 Identities = 11/40 (27%), Positives = 27/40 (67%) Query: 211 RGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRT 250 + ++ ++P++ DE+ +E G+ ++V ++ +D W G + RT Sbjct: 60 KAMYGYSPQNEDELPLEEGEEVFVLEKCDDGWFVGHSTRT 99 >SB_39120| Best HMM Match : SH3_1 (HMM E-Value=2e-20) Length = 524 Score = 33.1 bits (72), Expect = 0.44 Identities = 17/56 (30%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Query: 213 LHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVDMDYND 268 ++ + DE+ + GD I V + + W G L G+QG FPS Y ++ + D Sbjct: 315 MYPYEANRADELTITPGDVITVLYQDNENWWMG-ELADGRQGYFPSNYIMEKEELD 369 >SB_52289| Best HMM Match : SH3_1 (HMM E-Value=3.5e-13) Length = 803 Score = 33.1 bits (72), Expect = 0.44 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 16/100 (16%) Query: 181 PKSLSPIPLQQNGNMTTVPHSQLEMLEAT-----------HRGLHKFNPRHHDEIEVEIG 229 P +L +P ++N ++ T + L + T R L+++ + E+ + Sbjct: 326 PAALPAVPTEENADLYTTVNEVLPPQKPTARVPARPKERYFRALYEYEAQGDQELSFKAS 385 Query: 230 DPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVDMDYNDF 269 D I E +D WC G G++G+FP + +D+N F Sbjct: 386 DIIRFLYEEDDTWCCGE--LNGKKGMFPKEF---VDWNTF 420 >SB_55426| Best HMM Match : SH3_1 (HMM E-Value=1.90002e-41) Length = 689 Score = 32.7 bits (71), Expect = 0.58 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 5/55 (9%) Query: 210 HRGLHKFNPRHHDEIEVEIGDPIYVQKE---AEDLWCEGVNLRTGQQGIFPSAYA 261 +R L+ F PR+ DEIEV D + V + A W G G+ G+FP+ YA Sbjct: 16 YRVLYAFEPRNPDEIEVNEDDIVTVDHDNCTAPPGWLRG--KCHGKTGLFPANYA 68 >SB_48483| Best HMM Match : SH3_1 (HMM E-Value=7.1e-23) Length = 936 Score = 32.7 bits (71), Expect = 0.58 Identities = 15/48 (31%), Positives = 26/48 (54%) Query: 213 LHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 L+ F + E+ + G+ I V + +D W +G TG++G+FP Y Sbjct: 6 LYDFVAQEAGELNFKKGNHIEVLDKEDDNWWKGRVAETGEEGLFPRNY 53 >SB_42788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 617 Score = 32.7 bits (71), Expect = 0.58 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 2/54 (3%) Query: 211 RGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVDM 264 + ++ + DE+ + GD I V ++ W +G +L QQGIFP++Y ++ Sbjct: 566 KAIYDYQATQSDELTIHPGDIITVTARLDNGWWQG-DL-NNQQGIFPASYVEEI 617 >SB_51657| Best HMM Match : SH3_1 (HMM E-Value=2.69999e-40) Length = 313 Score = 32.7 bits (71), Expect = 0.58 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 2/48 (4%) Query: 213 LHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 L+ F DE+ + GD I + + D W +G G GIFPS+Y Sbjct: 192 LYSFTGESEDELTMWAGDTIQLLEIVNDDWLKG--SLNGNTGIFPSSY 237 >SB_23213| Best HMM Match : SH3_1 (HMM E-Value=9.2e-12) Length = 979 Score = 32.3 bits (70), Expect = 0.76 Identities = 17/54 (31%), Positives = 27/54 (50%) Query: 207 EATHRGLHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY 260 +A ++ L ++NP EI + GD + +E W L T QQG P++Y Sbjct: 921 KALYKALAEYNPVEAGEIALVEGDTVSFVREGNAGWWLVEQLSTRQQGWVPASY 974 >SB_27192| Best HMM Match : SH3_1 (HMM E-Value=0.53) Length = 96 Score = 31.9 bits (69), Expect = 1.0 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Query: 226 VEIGDPIYVQK--EAEDLWCEGVNLRTGQQGIFPSAY 260 +E GD + V K E+ + W G N RTGQ G FP Y Sbjct: 30 LETGDFLVVAKPFESAEGWLVGRNNRTGQYGEFPGTY 66 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 31.9 bits (69), Expect = 1.0 Identities = 22/92 (23%), Positives = 44/92 (47%), Gaps = 8/92 (8%) Query: 286 MGSVETLAHKGTGVVCQAVKKIVGECS-TEPTIQPCILEVSDQGLRMVDRSKPERNRNGP 344 +G E +G + A+KK+ + T Q I+ V+ +G+R++D E+++ Sbjct: 49 LGLKEVSGPRGDTICIDAIKKLKQQIKQTGEHKQKIIMAVNLRGIRILD----EKSK--- 101 Query: 345 CIDYFYSLKNVSFCAFHPRDHRYLGFITKHPT 376 + Y +++ VSF P D + G++ T Sbjct: 102 ALVYEHAINKVSFITHDPEDKKIFGYVCSQAT 133 >SB_33664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 525 Score = 30.7 bits (66), Expect = 2.3 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Query: 213 LHKFNPRHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGIFPSAY-AVDMDYNDFDP 271 L+ ++ R ++++ + G+ + + + W +L T Q+G PS Y A +M D Sbjct: 83 LYDYDARTNEDLSFKKGERLQLLDNTDGDWWLAKSLSTDQEGYIPSNYVAPEMSVKSQDW 142 Query: 272 ANAKVKR 278 K+KR Sbjct: 143 FFGKIKR 149 >SB_19980| Best HMM Match : rve (HMM E-Value=0.91) Length = 367 Score = 30.3 bits (65), Expect = 3.1 Identities = 13/37 (35%), Positives = 21/37 (56%) Query: 219 RHHDEIEVEIGDPIYVQKEAEDLWCEGVNLRTGQQGI 255 +H E+ +E+G +Y+ EDL +G T +QGI Sbjct: 199 KHPLEVPLEVGTEVYIATNEEDLQDKGRRRATDKQGI 235 >SB_44865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 495 Score = 29.9 bits (64), Expect = 4.1 Identities = 30/135 (22%), Positives = 53/135 (39%), Gaps = 15/135 (11%) Query: 281 YLLGYMGSVETLAHKGTGVVCQAVKKIVGECST------EPTIQPCILEVSDQGLRMVDR 334 + + ++G+ KG G V++IV E E +Q +L V + + + D Sbjct: 182 FYVKWLGTRRVFDAKGPGCTDDTVREIVEEAKHLKMSHHEAKLQKVLLTVYTKKITIADM 241 Query: 335 SKPERNRNGPCIDYFYSLKNVSFCAFHPRDHRYLGFITKHPTLQRFACH-VFRGQES-TR 392 P + VS+C P + FI + + ++ CH V +ES + Sbjct: 242 ETKVTKLEAP-------IYRVSYCTADPYFPKVFAFIVREQSSRKLYCHTVLCSKESMAK 294 Query: 393 PVAEAVGRAFQRFYQ 407 +A V AF Y+ Sbjct: 295 AIALTVADAFTVAYE 309 >SB_27584| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 7381 Score = 29.9 bits (64), Expect = 4.1 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Query: 232 IYVQKEAEDLWCEGVNLRTGQQGIFPSAYAVDMDYNDFDPANAKVKRERYLLG 284 +Y + E LW V + +G+ P+ Y V + + F P A+++R +Y G Sbjct: 2666 LYGCRRGERLWDNAVGMHSGRIKTRPN-YCVIIRHRQFAPHQARLRRHKYRNG 2717 >SB_34508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.1 bits (62), Expect = 7.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Query: 171 STAHSPIDTGPKSLSPIPLQQNGNMTTVP 199 S++HSP++ P + SP +GN TT P Sbjct: 67 SSSHSPLNNPPTTSSPGNASSSGNSTTSP 95 >SB_33954| Best HMM Match : Ion_trans_2 (HMM E-Value=0.74) Length = 330 Score = 28.7 bits (61), Expect = 9.4 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 1/81 (1%) Query: 256 FPSAYAVDMDYNDFDPANAKVKRERYLLGYMGSVETLAHKGTGVVCQAVKKIVGECSTEP 315 FP +D + +D + ++AK + + GS+ +++ G + + + +I S Sbjct: 140 FPRMSKIDSEASDSEQSHAKTRSQALSPDTSGSMTNISN-GLRGISEVMLQITAPVSRRM 198 Query: 316 TIQPCILEVSDQGLRMVDRSK 336 I PC + +G R R K Sbjct: 199 AISPCPTPPNKRGSRKKRRLK 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.320 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,354,447 Number of Sequences: 59808 Number of extensions: 606342 Number of successful extensions: 1443 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 16 Number of HSP's that attempted gapping in prelim test: 1420 Number of HSP's gapped (non-prelim): 37 length of query: 422 length of database: 16,821,457 effective HSP length: 84 effective length of query: 338 effective length of database: 11,797,585 effective search space: 3987583730 effective search space used: 3987583730 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 61 (28.7 bits)
- SilkBase 1999-2023 -