BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000570-TA|BGIBMGA000570-PA|IPR001452|Src homology-3, IPR006020|Phosphotyrosine interaction region (422 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 25 0.92 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 4.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 4.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 6.5 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 25.4 bits (53), Expect = 0.92 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Query: 153 SSPDSERLQSLGDVDSGH-STAHSPIDTGPKSLSPIPLQQNG 193 SSPDS R Q +G + H +TAH+ G + +P +G Sbjct: 392 SSPDSARHQRIGGCNGLHTTTAHNRFLGGIGGYNGLPTVMSG 433 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 4.9 Identities = 13/61 (21%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Query: 189 LQQNGNMTTVPHSQLEMLEATHRGLHKFNPRH-HDEIEVEIGDPIYVQKEAEDLWCEGVN 247 ++ GN + S+++ L+A+H + + +P D +E+ + Y+ + + + VN Sbjct: 583 IESLGNYYKIRDSKVKTLDASHNRITELSPLSVPDSVELLFINNNYINLVRPNTFTDKVN 642 Query: 248 L 248 L Sbjct: 643 L 643 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 4.9 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query: 295 KGTGVVCQAV-KKIVGECSTEPTIQPCILEVSDQGLRMVDRSKPERNRNG 343 K +GV A IV + T+P + CI+ SDQ + V R+ N G Sbjct: 319 KDSGVAKDAAYDNIVLKLLTKPRARGCIIFGSDQEVAGVMRAVKRCNATG 368 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.6 bits (46), Expect = 6.5 Identities = 8/19 (42%), Positives = 12/19 (63%) Query: 192 NGNMTTVPHSQLEMLEATH 210 NG+ + PH QL ++TH Sbjct: 803 NGDQSQPPHQQLHHHQSTH 821 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.320 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,028 Number of Sequences: 429 Number of extensions: 5080 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 6 Number of HSP's gapped (non-prelim): 4 length of query: 422 length of database: 140,377 effective HSP length: 59 effective length of query: 363 effective length of database: 115,066 effective search space: 41768958 effective search space used: 41768958 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.8 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -