SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTP 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BGIBMGA000569-TA|BGIBMGA000569-PA|undefined
         (140 letters)

Database: celegans 
           27,539 sequences; 12,573,161 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z66567-3|CAA91489.1|  444|Caenorhabditis elegans Hypothetical pr...    27   6.5  

>Z66567-3|CAA91489.1|  444|Caenorhabditis elegans Hypothetical
           protein ZK455.3 protein.
          Length = 444

 Score = 26.6 bits (56), Expect = 6.5
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 72  INNRRILSTNPFYYNVLLCKRPNVIHETISRSRKVSAVTGVIFAAIVYIATLHRA 126
           +N R  + ++ F    +LC R  +  +TIS  RK+  +   IFA I+ +  +  A
Sbjct: 12  VNTRSPIDSHLF--RKILCFR--IYDDTISFERKIGIIIPTIFAVIILVGLVGNA 62


  Database: celegans
    Posted date:  Oct 5, 2007 11:13 AM
  Number of letters in database: 12,573,161
  Number of sequences in database:  27,539
  
Lambda     K      H
   0.323    0.135    0.400 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,093,487
Number of Sequences: 27539
Number of extensions: 114879
Number of successful extensions: 189
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 189
Number of HSP's gapped (non-prelim): 1
length of query: 140
length of database: 12,573,161
effective HSP length: 75
effective length of query: 65
effective length of database: 10,507,736
effective search space: 683002840
effective search space used: 683002840
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (22.0 bits)
S2: 55 (26.2 bits)

- SilkBase 1999-2023 -