BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000568-TA|BGIBMGA000568-PA|IPR006202|Neurotransmitter- gated ion-channel ligand-binding, IPR006029|Neurotransmitter-gated ion-channel transmembrane region, IPR006028|Gamma-aminobutyric acid A receptor, IPR002289|Gamma-aminobutyric-acid A receptor, beta subunit, IPR006201|Neurotransmitter-gated ion-channel (374 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pomb... 27 5.7 SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharo... 27 5.7 >SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 1254 Score = 26.6 bits (56), Expect = 5.7 Identities = 13/39 (33%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Query: 240 ASEKKLPECPPVGDPHTLSKMNTLSRCPPSRPSKTISQE 278 +S LP PP DP + ++L R P RP ++ +E Sbjct: 91 SSSSMLP--PPSSDPFSSPLSSSLHRSSPKRPHDSLGEE 127 >SPAC8E11.01c ||SPAC959.01|beta-fructofuranosidase|Schizosaccharomyces pombe|chr 1|||Manual Length = 508 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Query: 145 PSGLIVIISWVSFWLNRNATPARV 168 P G ++ ISW S W N P R+ Sbjct: 275 PDGRVISISWASNWNYTNDVPMRM 298 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.322 0.137 0.420 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,692,482 Number of Sequences: 5004 Number of extensions: 68622 Number of successful extensions: 130 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 127 Number of HSP's gapped (non-prelim): 3 length of query: 374 length of database: 2,362,478 effective HSP length: 74 effective length of query: 300 effective length of database: 1,992,182 effective search space: 597654600 effective search space used: 597654600 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 54 (25.8 bits)
- SilkBase 1999-2023 -