BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000567-TA|BGIBMGA000567-PA|IPR001320|Ionotropic glutamate receptor, IPR001828|Extracellular ligand-binding receptor (500 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 6.5 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 6.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 6.5 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 6.5 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 6.5 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 445 VGTVW-WFFALILVCSYTANL-AAYLIVERIAAPMQSISYTSTLPNIEVRANALL 497 +G V+ +FFALILV + A L + + I A + ++ T E+ NALL Sbjct: 1326 IGLVFVFFFALILVIQFVAMLFHRFGTIAHILASTE-LNLCCTKKKEELSPNALL 1379 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 6.5 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 445 VGTVW-WFFALILVCSYTANL-AAYLIVERIAAPMQSISYTSTLPNIEVRANALL 497 +G V+ +FFALILV + A L + + I A + ++ T E+ NALL Sbjct: 1326 IGLVFVFFFALILVIQFVAMLFHRFGTIAHILASTE-LNLCCTKKKEELSPNALL 1379 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 6.5 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 445 VGTVW-WFFALILVCSYTANL-AAYLIVERIAAPMQSISYTSTLPNIEVRANALL 497 +G V+ +FFALILV + A L + + I A + ++ T E+ NALL Sbjct: 1326 IGLVFVFFFALILVIQFVAMLFHRFGTIAHILASTE-LNLCCTKKKEELSPNALL 1379 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 6.5 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 3/55 (5%) Query: 445 VGTVW-WFFALILVCSYTANL-AAYLIVERIAAPMQSISYTSTLPNIEVRANALL 497 +G V+ +FFALILV + A L + + I A + ++ T E+ NALL Sbjct: 1326 IGLVFVFFFALILVIQFVAMLFHRFGTIAHILASTE-LNLCCTKKKEELSPNALL 1379 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.322 0.136 0.403 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,390 Number of Sequences: 317 Number of extensions: 4457 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 4 length of query: 500 length of database: 114,650 effective HSP length: 60 effective length of query: 440 effective length of database: 95,630 effective search space: 42077200 effective search space used: 42077200 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -