BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000565-TA|BGIBMGA000565-PA|IPR003198|Amidinotransferase (263 letters) Database: tribolium 317 sequences; 114,650 total letters Searching....................................................done Score E Sequences producing significant alignments: (bits) Value DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 25 0.77 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 7.2 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 24.6 bits (51), Expect = 0.77 Identities = 28/99 (28%), Positives = 39/99 (39%), Gaps = 4/99 (4%) Query: 139 LAETFPEFPCTPIKMSKGAEHLKKYITVAGDDVLCVGASQEAKELLKRM-EREANFSYQT 197 LA FPE I+ G+ TVAGD VL A++ ++ + + E F + Sbjct: 153 LAWEFPENKPKKIRSKLGSIWHSVKKTVAGDKVLDENAAEHREQFVSLVRELRGAFKAEN 212 Query: 198 LSVPEDEAANCLYVNGTLVHRAIEEIPEAFKVFCEKIDF 236 L V N VN T+ + P V E DF Sbjct: 213 LLVTLTVLPN---VNSTVYYDPRALSPNLEFVVLEAFDF 248 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 199 SVPEDEAANCLYVNGTLVHRAIEEIPEAFK 228 ++ +A +Y GT+ H EE+ E K Sbjct: 525 TIESQDAITRIYACGTMWHETPEEMMEFLK 554 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 7.2 Identities = 9/30 (30%), Positives = 15/30 (50%) Query: 199 SVPEDEAANCLYVNGTLVHRAIEEIPEAFK 228 ++ +A +Y GT+ H EE+ E K Sbjct: 525 TIESQDAITRIYACGTMWHETPEEMMEFLK 554 Database: tribolium Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 114,650 Number of sequences in database: 317 Lambda K H 0.321 0.137 0.397 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 53,307 Number of Sequences: 317 Number of extensions: 2004 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of query: 263 length of database: 114,650 effective HSP length: 56 effective length of query: 207 effective length of database: 96,898 effective search space: 20057886 effective search space used: 20057886 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 42 (21.0 bits)
- SilkBase 1999-2023 -