BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000564-TA|BGIBMGA000564-PA|IPR001382|Glycoside hydrolase, family 47 (533 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 29 0.096 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 25 1.6 DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. 23 4.8 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 4.8 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 23 4.8 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 6.3 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 23 8.3 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 29.1 bits (62), Expect = 0.096 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 11/100 (11%) Query: 313 TGKTINYLLDDYLTGIEG-VREFLAKRSSPNKRLFIGELSAGSE-----AFNPKMD---H 363 T K N L D+Y+ +E +R+ ++ SP + +I L E F P ++ Sbjct: 599 TSKHDNSLYDEYIPFLERELRKAHQEKDSPRIQTYIMALGMIGEPKILSVFEPYLEGKQQ 658 Query: 364 LTCFLPGTLALGHLNGLPDWHMTMAEELLYTCYL-TYAAH 402 +T F TL +G L L + + +A +LY YL T +H Sbjct: 659 MTVF-QRTLMVGSLGKLTETNPKLARSVLYKIYLNTMESH 697 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Query: 161 NKDVNFFEVTIRILGGLLTN 180 N D NF EV RILG + N Sbjct: 391 NNDFNFDEVNFRILGANVNN 410 >DQ435325-1|ABD92640.1| 160|Apis mellifera OBP7 protein. Length = 160 Score = 23.4 bits (48), Expect = 4.8 Identities = 17/62 (27%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Query: 139 MGLT-DVFEEGKQWIKEELIFTKNKDVNFFEVTIRILGGLLTNHYFTQDQLFLDKAIDLG 197 MGLT F + ++ ++EE I N + I L +H D++ LDK +++ Sbjct: 44 MGLTFKDFIKMQELLQEEDISEGNIKKYLTNYSCFITCALEKSHIIQNDEIQLDKLVEMA 103 Query: 198 DR 199 +R Sbjct: 104 NR 105 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 23.4 bits (48), Expect = 4.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 471 PNGYSSLTNVKSENPIP 487 PNGY+ L +KS + IP Sbjct: 38 PNGYAKLAAIKSGSYIP 54 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 23.4 bits (48), Expect = 4.8 Identities = 10/15 (66%), Positives = 10/15 (66%) Query: 161 NKDVNFFEVTIRILG 175 N D NF EV RILG Sbjct: 557 NNDYNFNEVNFRILG 571 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.0 bits (47), Expect = 6.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 421 DMYTKSADAHSLLRPEFIESLW 442 D + D + L PEF +SLW Sbjct: 51 DYIFEEGDDYVTLPPEFFDSLW 72 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 22.6 bits (46), Expect = 8.3 Identities = 10/25 (40%), Positives = 13/25 (52%) Query: 88 QRALVESFRHAWRGYKEHAWGHDNL 112 QR++ FR + R YK HD L Sbjct: 37 QRSVSSGFRSSLRNYKTLISSHDEL 61 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.319 0.135 0.412 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 148,813 Number of Sequences: 429 Number of extensions: 6297 Number of successful extensions: 20 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 15 Number of HSP's gapped (non-prelim): 7 length of query: 533 length of database: 140,377 effective HSP length: 61 effective length of query: 472 effective length of database: 114,208 effective search space: 53906176 effective search space used: 53906176 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 46 (22.6 bits)
- SilkBase 1999-2023 -