BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000563-TA|BGIBMGA000563-PA|IPR005962|Tyrosine 3-monooxygenase, IPR001273|Aromatic amino acid hydroxylase (561 letters) Database: mosquito 2123 sequences; 516,269 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 25 5.4 AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. 25 5.4 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 25.0 bits (52), Expect = 5.4 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Query: 272 YKYGDPIPSIAYTEIEN-GTWQRVFNTVLDLMPKHACREYKAAFE 315 YK GD +I Y I + +VF V+ HACR Y + ++ Sbjct: 606 YKKGDRTDAINYRGITSLCAIAKVFELVIYKNLLHACRSYLSPYQ 650 >AY578804-1|AAT07309.1| 133|Anopheles gambiae maverick protein. Length = 133 Score = 25.0 bits (52), Expect = 5.4 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Query: 371 QYVRHNNSPFHTPEPDCIHELLGHIPLL-ADPSFAQ 405 Q + H + + P+P C L HI +L ADP Q Sbjct: 80 QSLLHEHIKYDVPKPCCAPSSLDHIDVLHADPKNPQ 115 Database: mosquito Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 516,269 Number of sequences in database: 2123 Lambda K H 0.318 0.133 0.387 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,144 Number of Sequences: 2123 Number of extensions: 20963 Number of successful extensions: 24 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 0 Number of HSP's successfully gapped in prelim test: 2 Number of HSP's that attempted gapping in prelim test: 24 Number of HSP's gapped (non-prelim): 2 length of query: 561 length of database: 516,269 effective HSP length: 67 effective length of query: 494 effective length of database: 374,028 effective search space: 184769832 effective search space used: 184769832 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits) S2: 50 (24.2 bits)
- SilkBase 1999-2023 -