BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000562-TA|BGIBMGA000562-PA|IPR000210|BTB, IPR003131|K+ channel tetramerisation (157 letters) Database: bee 429 sequences; 140,377 total letters Searching.....................................................done Score E Sequences producing significant alignments: (bits) Value DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 21 5.8 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 5.8 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 21.0 bits (42), Expect = 5.8 Identities = 6/17 (35%), Positives = 11/17 (64%) Query: 61 LKQHYFIDRDGGMFRHI 77 +K+ F+D+DG H+ Sbjct: 67 MKKFSFVDKDGNFNEHV 83 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 5.8 Identities = 15/59 (25%), Positives = 26/59 (44%) Query: 95 MELLLHEAHYFELDHMVFALSKLKHGREGVKHECEWLSDASDRLKQETELLMQERDRLQ 153 +E+ H E D ++F S +G EG+ ++SD +L+ E+ R Q Sbjct: 374 LEMKGQMVHCPESDSILFVSSPFLNGLEGLTGRGLFISDIPLHDATRDVILVGEQARAQ 432 Database: bee Posted date: Oct 5, 2007 11:13 AM Number of letters in database: 140,377 Number of sequences in database: 429 Lambda K H 0.322 0.138 0.419 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,727 Number of Sequences: 429 Number of extensions: 1956 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 157 length of database: 140,377 effective HSP length: 53 effective length of query: 104 effective length of database: 117,640 effective search space: 12234560 effective search space used: 12234560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.9 bits) S2: 41 (20.6 bits)
- SilkBase 1999-2023 -