BLASTP 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BGIBMGA000561-TA|BGIBMGA000561-PA|undefined (66 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 27 0.41 SPBC1685.02c |rps1202|rps12-2|40S ribosomal protein S12|Schizosa... 23 3.8 SPCC962.04 |rps1201|rps12-1, rps12|40S ribosomal protein S12|Sch... 23 3.8 SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosacchar... 22 8.7 SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit ... 22 8.7 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 26.6 bits (56), Expect = 0.41 Identities = 14/33 (42%), Positives = 17/33 (51%) Query: 16 FSEEDCIRQGGICVRTEECDPDNISTISQFLCP 48 FS DC RQ I + E D ST+ F+CP Sbjct: 1381 FSFVDCTRQITIYLAKTELLSDLYSTLLSFVCP 1413 >SPBC1685.02c |rps1202|rps12-2|40S ribosomal protein S12|Schizosaccharomyces pombe|chr 2|||Manual Length = 148 Score = 23.4 bits (48), Expect = 3.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 23 RQGGICVRTEECDPDNISTISQFLC 47 RQ +CV E CD + + + LC Sbjct: 63 RQAHLCVLCESCDQEAYVKLVEALC 87 >SPCC962.04 |rps1201|rps12-1, rps12|40S ribosomal protein S12|Schizosaccharomyces pombe|chr 3|||Manual Length = 145 Score = 23.4 bits (48), Expect = 3.8 Identities = 9/25 (36%), Positives = 13/25 (52%) Query: 23 RQGGICVRTEECDPDNISTISQFLC 47 RQ +CV E CD + + + LC Sbjct: 60 RQAHLCVLCESCDQEAYVKLVEALC 84 >SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosaccharomyces pombe|chr 1|||Manual Length = 556 Score = 22.2 bits (45), Expect = 8.7 Identities = 9/24 (37%), Positives = 14/24 (58%) Query: 1 MAVTVCSSPLLTQTPFSEEDCIRQ 24 +A +VCS P Q FS D +++ Sbjct: 466 LANSVCSGPTYWQDAFSLTDALKE 489 >SPCC1840.02c |bgs4|orb11, cwg1|1,3-beta-glucan synthase subunit Bgs4|Schizosaccharomyces pombe|chr 3|||Manual Length = 1955 Score = 22.2 bits (45), Expect = 8.7 Identities = 7/26 (26%), Positives = 15/26 (57%) Query: 19 EDCIRQGGICVRTEECDPDNISTISQ 44 E+C++ + EE + DN++ S+ Sbjct: 1173 EECLKIRSVLAEFEEMETDNVNPYSE 1198 Database: spombe Posted date: Oct 3, 2007 3:31 PM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.323 0.135 0.435 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 318,128 Number of Sequences: 5004 Number of extensions: 9672 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 5 length of query: 66 length of database: 2,362,478 effective HSP length: 46 effective length of query: 20 effective length of database: 2,132,294 effective search space: 42645880 effective search space used: 42645880 T: 11 A: 40 X1: 16 ( 7.5 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (22.0 bits) S2: 45 (22.2 bits)
- SilkBase 1999-2023 -